• USA Home
  • SAB2105080 - Anti-ZNF746 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105080 Sigma

Anti-ZNF746 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ31413

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, ZNF4-ZNR
species reactivity   mouse, rat, rabbit, guinea pig, human
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
mol wt   mol wt 69 kDa
storage temp.   −20°C
Gene Information   human ... ZNF746(155061)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_152557

Description

Immunogen

The immunogen for anti-ZNF746 antibody: synthetic peptide derected towards the middle region of human ZNF746

Physical form

Lyophilized from PBS buffer with 2% sucrose

Sequence

Synthetic peptide located within the following region: TGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?