• USA Home
  • SAB2105081 - Anti-KIF2B antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105081 Sigma

Anti-KIF2B antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, KIA-KIT, Primary Antibodies
species reactivity   horse, guinea pig, human, rabbit
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 76 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... KIF2B(84643)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_032559

Description

Immunogen

The immunogen for anti-KIF2B antibody: synthetic peptide derected towards the middle region of human KIF2B

General description

KIF2B (kinesin family member 2B) belongs to the kinesin-13 family. It is present with spindles, centrosomes and unaligned kinetochores. The gene is mapped to human chromosome 17q22.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

KIF2B (kinesin family member 2B) is involved in the regulation of microtubule dynamics. It is crucial for spindle assembly, chromosome movement and cytokinesis. KIF2B also associates with CEP170 (centrosomal protein 170kDa).

Sequence

Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?