• USA Home
  • SAB2105132 - Anti-EGR1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105132 Sigma

Anti-EGR1 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-AT225, Anti-G0S30, Anti-KROX-24, Anti-NGFI-A, Anti-TIS8

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, E-EI, Primary Antibodies
species reactivity   human, horse, sheep, rabbit, guinea pig
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 57 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... EGR1(1958)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_001964

Description

Immunogen

The immunogen for anti-EGR1 antibody: synthetic peptide derected towards the middle region of human EGR1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?