• USA Home
  • SAB2105157 - Anti-TM9SF4, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105157 Sigma

Anti-TM9SF4, (N-terminal) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym: Anti-KIAA0255

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TK-TM
species reactivity   mouse, rabbit, horse, human, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR
mol wt   mol wt 72 kDa
storage temp.   −20°C
Gene Information   human ... TM9SF4(9777)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_014742

Description

Immunogen

Peptide region of the protein sequence according to NP_055557.

Physical form

Antibody is lyophilized from PBS buffer with 2% sucrose.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  2
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?