• USA Home
  • SAB2108222 - Anti-SLC2A4 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2108222 Sigma

Anti-SLC2A4 antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, SLA-SLC2
species reactivity   rabbit, rat, human, zebrafish, guinea pig, canine, mouse, bovine, horse, pig
application(s)   immunoblotting: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 55kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... SLC2A4(6517)
biological source   from rabbit
conjugate   unconjugated
NCBI accession no.   NM_001042

Description

Immunogen

The immunogen for anti-SLC2A4 antibody: synthetic peptide directed towards the N terminal of human SLC2A4

General description

Solute carrier family 2 member 4 (SLC2A4) is also known as glucose transporter-4 (GLUT4). It is highly expressed in adipose tissue and skeletal muscles. The gene encoding SLC2A4 is localized on human chromosome 17p13.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

Solute carrier family 2 member 4 (SLC2A4) transports glucose into cells in response to insulin. Levels of this protein have been shown to be reduced in type 2 diabetes.

Sequence

Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?