• USA Home
  • SAB2108244 - Anti-TRIM8 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2108244 Sigma

Anti-TRIM8 antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TR-TR
species reactivity   canine, rabbit, horse, zebrafish, bovine, mouse, rat, human
application(s)   immunoblotting: suitable
  immunohistochemistry: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 61kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TRIM8(81603)
biological source   from rabbit
conjugate   unconjugated
NCBI accession no.   NM_030912

Description

Immunogen

The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the N terminal of human TRIM8

General description

The gene TRIM8 (tripartite motif containing 8) encodes a RING (really interesting new gene) finger protein that contains a tripartite motif. It spans a length of 551-amino acids. The gene maps to human chromosome 10q24.3. The encoded protein contains a RING finger and a coiled-coil domain interspaced by two B boxes. It is universally expressed in adult tissues and several cancers.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

The gene TRIM8 (tripartite motif containing 8) encodes a member of the RBCC (RING finger, B-box, and coiled-coil) subclass of proteins, which are involved in several processes, such as development and cell-growth regulation. Trim8 interacts with the SH2 domain and the SOCS box of SOCS-1 (suppressor of cytokine signaling), and regulates IFN-γ (Interferon γ) cytokine signaling. Trim8 also positively regulates tumor necrosis factor-α (TNFα) and interleukin-1β (IL-1β)–triggered activation of NF-κB (nuclear factor-κB), a transcription factor that participates in cell proliferation, inhibition of apoptosis, and innate immunity. Cellular stress induces the expression of this protein, which in turn stabilizes p53 resulting in cell cycle arrest and reduction of cell proliferation. Mutations in this gene have been associated with Mendelian disease, several types of cancer and viral infection.

Sequence

Synthetic peptide located within the following region: RGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIVEKFNALHVEK

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?