• USA Home
  • SAB2108279 - Anti-OGDH antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2108279 Sigma

Anti-OGDH antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, O, Primary Antibodies
species reactivity   human, rat, bovine, guinea pig, canine, mouse, horse, rabbit
application(s)   immunoblotting: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 47kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... OGDH(4967)
biological source   from rabbit
conjugate   unconjugated
NCBI accession no.   NM_001003941

Description

Immunogen

The immunogen for anti-OGDH antibody: synthetic peptide directed towards the N terminal of human OGDH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?