• USA Home
  • SAB2108280 - Anti-PITX3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2108280 Sigma

Anti-PITX3 antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PH-PI, Primary Antibodies
species reactivity   rabbit, human, canine, rat, guinea pig, bovine, mouse, horse, zebrafish
application(s)   immunoblotting: suitable
  immunohistochemistry: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 32kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PITX3(5309)
biological source   from rabbit
conjugate   unconjugated
NCBI accession no.   NM_005029

Description

Immunogen

The immunogen for anti-PITX3 antibody: synthetic peptide directed towards the N terminal of human PITX3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?