• USA Home
  • SRP0164 - Histone H4 (2-58) human

EMAIL THIS PAGE TO A FRIEND
SRP0164 Sigma

Histone H4 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Synonym: HIST2H4A

Purchase

Properties

Related Categories Cell Culture, Epigenetics, Growth Factors and Cytokines, Histones, Molecular Biology,
recombinant   expressed in E. coli
assay   ≥70% (SDS-PAGE)
form   aqueous solution
mol wt   mol wt 32 kDa
NCBI accession no.   NM_003548
shipped in   dry ice
storage temp.   −70°C
Gene Information   human ... HIST2H4A(8370)

Description

Frequently Asked Questions

Frequently Asked Questions are available for this Product.

General description

Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.

Preparation Note

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Physical form

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Price and Availability

Safety & Documentation

Safety Information

Safety Information for this product is unavailable at this time.

Frequently Asked Questions

Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis. These documents are located on the product detail page under Useful Links & Tools. Click on the following link to search for a Certificate of Analysis. Please click the following link to see the details on our Product Dating Information.
How do I get lot-specific information or a Certificate of Analysis?
A Certificate of Analysis is available by lot number and can be obtained through our Advanced Search Option: http://www.sigmaaldrich.com/catalog/AdvancedSearchPage.do
How do I find price and availability?
There are several ways to find pricing and availability for our products.  Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers. 
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS. To access the shipping information for this material, use the link on the product detail page for the product, or search here. 
My question is not addressed here, how can I contact Technical Service for assistance?
Use the option to the right to "Ask a Question" by email of a Technical Service Scientist.
What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?
The sequence for Product SRP0164, Histone H4 (2-58) human is as follows: SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
Show more questions
Protocols & Articles

Articles

Histone Modification and Chromatin Remodeling

Gene expression is governed by complex mechanisms including transcription factor binding to DNA and coordinated changes in chromatin structure. The primary protein components of chromatin are the his...
Savita Bagga, PhD.
BioFiles v7 n3, 2012, 10–16
Keywords: Acetylations, Amplification, Cancer, Cell culture, Chromatin immunoprecipitation, Cloning, DNA purification, Diseases, Gene expression, Immunoprecipitation, Indicators, Methylations, Microarray Analysis, PAGE, Polymerase chain reaction, Polymerase chain reaction - quantitative, Polymorphisms, Purification, Sequencing, Transcription, Whole genome amplification

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?