WH0000199M1 Sigma

Monoclonal Anti-AIF1 antibody produced in mouse

clone 2A2-B6, purified immunoglobulin, buffered aqueous solution

DOWNLOAD MSDS (PDF)

Synonym: Anti-AIF1, Anti-IBA1, Anti-IRT1, Anti-allograft inflammatory factor 1

Properties

Related Categories 2-2B, AE-AK, Alphabetical Index, Antibodies, Clone Index,
species reactivity   human
application(s)   indirect ELISA: suitable
  western blot: suitable
clone   2A2-B6, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1κ
immunogen sequence   MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP* (without GST)
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... AIF1(199)

Description

Immunogen

AIF1 (AAH09474, a.a. 1-148) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Price and Availability

Anti-Mouse 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A4416HRPAnti-Mouse IgG (whole molecule)-Peroxidase
A3562APAnti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257FITCAnti-Mouse IgG (whole molecule)-FITC
B7264BiotinAnti-Mouse IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-AIF antibody produced in rabbit

affinity isolated antibody, buffered aqueous solution

Anti-AIF1 (72-84) antibody produced in rabbit

IgG fraction of antiserum, buffered aqueous solution

Anti-AIF1/IBA1 (Isoform 3) antibody produced in goat

affinity isolated antibody, buffered aqueous solution

Anti-AIF1/IBA1 (Isoforms 1 and 3) (AB1) antibody produced in goat

affinity isolated antibody, buffered aqueous solution

Anti-AIF1/IBA1 (Isoforms 1 and 3) (AB2) antibody produced in goat

affinity isolated antibody, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?