GRM1 monoclonal antibody | Western, ELISA | WH0002911M2

Properties

Related Categories	1E-1F, Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Neurotransmission, Antibodies to Glutamate Receptors, Antibodies to Ion Channels, Antibodies to Ligand-Gated Ion Channels, Antibodies to Neurotransmitter Receptors, Clone Index, GR-GZ, Neuroscience, Primary Antibodies More...
species reactivity	human
application(s)	indirect ELISA: suitable
	western blot: suitable
clone	1F7, monoclonal
antibody form	purified immunoglobulin
form	buffered aqueous solution
isotype	IgG2bκ
immunogen sequence	NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY* (without GST)
shipped in	dry ice
storage temp.	−20°C
Gene Information	human ... GRM1(2911)

Description

Immunogen

GRM1 (NP_000829, a.a. 387-487) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers

Prod. No.	Conjugate	Secondary Antibody Description
A4416	HRP	Anti-Mouse IgG (whole molecule)-Peroxidase
A3562	AP	Anti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257	FITC	Anti-Mouse IgG (whole molecule)-FITC
B7264	Biotin	Anti-Mouse IgG (whole molecule)-Biotin