PECAM1 monoclonal antibody | Immunohistochemistry, Western, ELISA | WH0005175M1

Properties

Related Categories	1C-1D, Alphabetical Index, Analytical Cytology, Antibodies, Antibodies for Cell Biology, Antibodies for Immune Cell Signaling and Blood, Antibodies to Adhesion Molecules and Related Proteins, Antibodies to Cytoskeleton, Antibodies to Human Leukocytes, Clone Index, PD-PG, Primary Antibodies More...
species reactivity	human
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
	indirect ELISA: suitable
	western blot: suitable
clone	1D2-1A5, monoclonal
antibody form	purified immunoglobulin
form	buffered aqueous solution
isotype	IgG1κ
immunogen sequence	ENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNR (without GST)
shipped in	dry ice
storage temp.	−20°C
Gene Information	human ... PECAM1(5175)

Description

Immunogen

PECAM1 (AAH22512, a.a. 29-739) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers

Prod. No.	Conjugate	Secondary Antibody Description
A4416	HRP	Anti-Mouse IgG (whole molecule)-Peroxidase
A3562	AP	Anti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257	FITC	Anti-Mouse IgG (whole molecule)-FITC
B7264	Biotin	Anti-Mouse IgG (whole molecule)-Biotin