WH0079923M1 Sigma

Monoclonal Anti-NANOG antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

DOWNLOAD MSDS (PDF)

Synonym: Anti-Nanog homeobox

Properties

Related Categories 2C-2E, Alphabetical Index, Antibodies, Antibodies to Transcription Factors, Clone Index,
species reactivity   human
application(s)   indirect ELISA: suitable
  western blot: suitable
clone   2C11, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2bκ
immunogen sequence   TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM* (without GST)
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... NANOG(79923)

Description

Immunogen

NANOG (NP_079141, a.a. 98-196) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A4416HRPAnti-Mouse IgG (whole molecule)-Peroxidase
A3562APAnti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257FITCAnti-Mouse IgG (whole molecule)-FITC
B7264BiotinAnti-Mouse IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-NANOG (AB1) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Anti-NANOG (AB2) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Anti-NANOG antibody produced in goat

affinity isolated antibody, buffered aqueous solution

~1 mg/mL, affinity isolated antibody, buffered aqueous solution

Monoclonal Anti-Nanog antibody produced in mouse

~2 mg/mL, clone NNG-811, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?