Application
Prestige Antibodies
™ Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project
(www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these
protocols and other useful information about Prestige Antibodies and the HPA, visit
sigma.com/prestige.
Immunogen
Complement C1q tumor necrosis factor-related protein 6 precursor recombinant protein epitope signature tag (PrEST)
Immunogen sequence: CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMAT
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.