Anti-HPA003652 antibody produced in rabbit 

Prestige Antibodies^™ Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Retrotransposon gag domain-containing protein 4 recombinant protein epitope signature tag (PrEST). The PrEST immunogen for HPA003652 has human similarity to ENSP00000316794 (ZCCHC5) of 29%.

Immunogen sequence: ISVTQEGSPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEFFRKELLWSTEMADLDELILE

Note: in the 48:36 release of the Ensembl database this antibody's immunogen has less tha 80% homology with the 48:36 release Ensembl GENE ID ENSG00000179300.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.

affinity isolated antibody

Prestige Antibodies^™ Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

immunoblotting: suitable

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

protein array: suitable

wet ice

−20°C