Anti-TAF6 antibody produced in rabbit 

Prestige Antibodies^™ Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Transcription initiation factor TFIID subunit 6 recombinant protein epitope signature tag (PrEST)

Immunogen sequence: LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.

affinity isolated antibody

Prestige Antibodies^™ Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

immunoblotting: suitable

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

protein array: suitable

human ... TAF6(6878)

wet ice

−20°C