Merck
Todas as fotos(1)

Documentos

APREST79898

Sigma-Aldrich

PrEST Antigen BRAF

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Faça loginto View Organizational & Contract Pricing

Select a Size

Sinônimo(s):
BRAF1

recombinante

expressed in E. coli

Nível de qualidade

Ensaio

>80% (SDS-PAGE)

forma

buffered aqueous solution

peso molecular

predicted mol wt 33 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentração

≥0.5 mg/mL

sequência de imunogênio

PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS

Ensembl | Número de adesão de ser humano

nº de adesão UniProt

enviado em

wet ice

temperatura de armazenamento

−20°C

Gene Information

human ... BRAF(673)

Comparar Itens Semelhantes

Ver Comparação Total

Mostrar diferenças

1 of 4

Este Item
SAB5600047APREST88439APREST78601
PrEST Antigen BRAF Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution

Sigma-Aldrich

APREST79898

PrEST Antigen BRAF

PrEST Antigen ARAF Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution

Sigma-Aldrich

APREST88439

PrEST Antigen ARAF

PrEST Antigen RABAC1 Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution

Sigma-Aldrich

APREST78601

PrEST Antigen RABAC1

assay

>80% (SDS-PAGE)

assay

-

assay

>80% (SDS-PAGE)

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

form

buffered aqueous glycerol solution

form

buffered aqueous solution

form

buffered aqueous solution

mol wt

predicted mol wt 33 kDa

mol wt

-

mol wt

predicted mol wt 25 kDa

mol wt

predicted mol wt 24 kDa

purified by

immobilized metal affinity chromatography (IMAC)

purified by

-

purified by

immobilized metal affinity chromatography (IMAC)

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

concentration

~1 mg/mL

concentration

≥0.5 mg/mL

concentration

≥0.5 mg/mL

Descrição geral

Recombinant protein fragment of Human BRAF with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicação

Suitable as a blocking agent using corresponding antibodies.

Ligação

Corresponding Antibody HPA001328.

forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparo

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Informações legais

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de classe de armazenamento

10 - Combustible liquids

WGK

WGK 2

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Os números dos produtos são combinados com os tamanhos/quantidades da embalagem quando exibidos no site (exemplo: T1503-25G). Por favor, certifique-se você insere APENAS o número do produto no campo Número do produto (exemplo: T1503).

Exemplo

T1503
Número do produto
-
25G
Tamanho/quantidade da embalagem

Exemplos adicionais:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

inserir como 1.000309185)

Está com problemas? Sinta-se à vontade para entrar em contato Assistência Técnica para obter assistência

Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Produtos Aldrich

  • Se encontrar um número de lote como TO09019TO - insira o número do lote 09019TO sem as duas primeiras letras.

  • Se encontrar um número de lote com um código de preenchimento, como 05427ES-021 - insira o número do lote 05427ES sem o código de preenchimento -021.

  • Se encontrar um número de lote com um código de preenchimento como STBB0728K9 - digite o número do lote STBB0728 sem o código de preenchimento K9.

Não encontra o que está procurando?

Em alguns casos, um COA pode não estar disponível on-line. Se a sua pesquisa não encontrou o COA, você pode solicitar um.

Solicitar COA

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica