APREST89249

Sigma-Aldrich

PrEST Antigen TP73

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Sinônimo(s):
P73

Nível de qualidade

100

recombinante

expressed in E. coli

teor

>80% (SDS-PAGE)

forma

buffered aqueous solution

peso molecular

predicted mol wt 28 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentração

≥0.5 mg/mL

sequência de imunogênio

RQQQQLLQRPSHLQPPSYGPVLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPP

Ensembl | Número de adesão de ser humano

nº de adesão UniProt

enviado em

wet ice

temperatura de armazenamento

−20°C

Gene Information

human ... TP73(7161)

Descrição geral

Recombinant protein fragment of Human TP73 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Aplicação

Blocking agent and positive assay control using corresponding antibodies.

Ligação

Corresponding Antibody HPA027314.

forma física

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota de preparo

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Informações legais

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

RIDADR

NONH for all modes of transport

WGK Alemanha

WGK 2

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise
Certificado de origem

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica

Redes sociais

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Pesquisa. Desenvolvimento. Produção.

Somos um fornecedor global líder para o setor de ciências biológicas, com soluções e serviços para pesquisa, desenvolvimento e produção de biotecnologia, além de produção e desenvolvimento de terapias farmacológicas com medicamentos.

© 2021 Merck KGaA, Darmstadt, Alemanha e/ou suas filiais. Todos os direitos reservados.

A reprodução não autorizada de quaisquer materiais deste site é estritamente proibida.