AV02017

Sigma-Aldrich

Anti-BRCA1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):
Anti-Breast cancer 1, early onset

fonte biológica

rabbit

Nível de qualidade

100

forma do anticorpo

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

peso molecular

76 kDa

species reactivity

human

embalagem

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

concentração

0.5 mg - 1 mg/mL

aplicação(ões)

western blot: suitable

conjugado

unconjugated

nº de adesão NCBI

nº de adesão UniProt

temperatura de armazenamento

−20°C

Gene Information

human ... BRCA1(672)

Descrição geral

BRCA1 has been identified as the susceptibility gene for breast and ovarian cancers. The protein encoded by this gene regulates normal embryonic growth. BRCA1 has also been implicated in prostate cancer.
Rabbit Anti-BRCA1 antibody binds to human, rat, and canine BRCA1.

Imunogênio

The immunogen for anti-BRCA1 antibody: synthetic peptide derected towards the N terminal of human BRCA1

Aplicação

Rabbit Anti-BRCA1 antibody can be used for western blot (0.5μg/ml) and immunohistochemical (4-8μg/ml, using paraffin-embedded tissues) applications.

Sequência

Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificado de análise

Certificado de origem

E M Rosen et al.
Cancer investigation, 19(4), 396-412 (2001-06-19)
The breast cancer susceptibility gene BRCA1 on chromosome 17q21 encodes an 1863 amino acid protein that is important for normal embryonic development. Germline mutations of this gene are linked to a significantly increased lifetime risk for breast and/or ovarian cancer...
Y Miki et al.
Science (New York, N.Y.), 266(5182), 66-71 (1994-10-07)
A strong candidate for the 17q-linked BRCA1 gene, which influences susceptibility to breast and ovarian cancer, has been identified by positional cloning methods. Probable predisposing mutations have been detected in five of eight kindreds presumed to segregate BRCA1 susceptibility alleles....
Feng Bai et al.
Cancer research, 74(21), 6161-6172 (2014-09-23)
BRCA1 mutation carriers are predisposed to developing basal-like breast cancers with high metastasis and poor prognosis. Yet, how BRCA1 suppresses formation of basal-like breast cancers is still obscure. Deletion of p18(Ink4c) (p18), an inhibitor of CDK4 and CDK6, functionally inactivates...
Bárbara Alcaraz Silva et al.
The Journal of biological chemistry, 289(33), 22771-22784 (2014-07-02)
Chromosome ends contain nucleoprotein structures known as telomeres. Damage to chromosome ends during interphase elicits a DNA damage response (DDR) resulting in cell cycle arrest. However, little is known regarding the signaling from damaged chromosome ends (designated here as "TIPs")...
Qing Xia et al.
International journal of oncology, 44(3), 735-744 (2014-01-01)
Breast cancer is one of the most common malignancies in women. Approximately 15% of the patients belong to the triple-negative breast cancer (TNBC) group, and have the disadvantage of not benefiting from currently available receptor-targeted systemic therapies. Some cancers in...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica