The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
https://www.uniprot.org/uniprotkb/P01133/entry
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
E9644
Epidermal Growth Factor, human
≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Sinônimo(s):
Fator de crescimento epidérmico, EGF
Faça login para ver os preços organizacionais e de contrato.
Selecione um tamanho
Alterar visualização
| Tamanho da embalagem | SKU | Disponibilidade | Preço |
|---|---|---|---|
| 0.2 mg | Previsão de envio para HOJEdeCajamar | R$ 1.383,00 | |
| 0.5 mg | Previsão de envio para HOJEdeCajamar | R$ 2.348,00 | |
| 5 x 0.2 mg | Verificar disponibilidade no carrinho | R$ 8.117,00 |
Sobre este item
Biological source:
human
Recombinant:
expressed in E. coli
Assay:
≥97% (SDS-PAGE)
Form:
lyophilized powder
Mol wt:
~6 kDa
Impurities:
≤1 EU/μg endotoxin (EGF)
R$ 1.383,00
Previsão de envio para HOJEDetalhes
Use o código promocional TWV no carrinho para aplicar um desconto a esse produto.
Assistência Técnica
Precisa de ajuda? Nossa equipe de cientistas experientes está à sua disposição.
Estamos aqui para ajudarNome do produto
hEGF, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
biological source
human
Quality Level
recombinant
expressed in E. coli
assay
≥97% (SDS-PAGE)
form
lyophilized powder
potency
0.08-0.8 ng/mL ED50/EC50
mol wt
~6 kDa
packaging
pkg of 5X0.2 mg, pkg of 0.2 mg, pkg of 0.5 mg
storage condition
avoid repeated freeze/thaw cycles
technique(s)
cell culture | mammalian: suitable
impurities
≤1 EU/μg endotoxin (EGF)
color
white
solubility
water: soluble, clear, colorless
UniProt accession no.
storage temp.
−20°C
SMILES string
S(CC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]%12N(CCC%12)C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N
InChI
1S/C270H401N73O83S7/c1-24-134(19)217(262(420)293-112-201(355)298-161(69-74-205(359)360)229(387)301-160(45-35-82-286-269(279)280)228(386)333-192(119-428)255(413)307-162(68-73-198(274)352)230(388)316-176(94-141-54-64-150(350)65-55-141)241(399)304-159(44-34-
InChI key
GVUGOAYIVIDWIO-UFWWTJHBSA-N
Gene Information
human ... EGF(1950)
Application
Biochem/physiol Actions
O fator de crescimento epidérmico (EGF) é um polipetídeo mitogênico pequeno presente em vários tecidos e fluidos corporais em muitas espécies de mamíferos. O EGF é um membro de uma família de fatores de crescimento caracterizado por 6 motivos de cisteína conservada que formam três pontes dissulfeto. O EGF é mitogênico para diversas células epidérmicas e epiteliais, inclusive fibroblastos, células gliais, células endoteliais vasculares e córneas, células da granulosa bovina, células HeLa, células SV40-3T3 e células epiteliais mamárias.
As funções celulares afetadas por EGF: mitose, fluxo iônico, transporte de glicose, síntese de ácidos nucleicos e proteínas, sobrevivência, crescimento, proliferação e diferenciação.
Efeitos biológicos do EGF: inibição da secreção gástrica de ácido, crescimento e desenvolvimento fetal, bem como neuromodulação no sistema nervoso central.
Vias afetadas pelo EGF: Sinalização do EGFR, cascata da MAPK, PIP, sinalização com Ca+2
As funções celulares afetadas por EGF: mitose, fluxo iônico, transporte de glicose, síntese de ácidos nucleicos e proteínas, sobrevivência, crescimento, proliferação e diferenciação.
Efeitos biológicos do EGF: inibição da secreção gástrica de ácido, crescimento e desenvolvimento fetal, bem como neuromodulação no sistema nervoso central.
Vias afetadas pelo EGF: Sinalização do EGFR, cascata da MAPK, PIP, sinalização com Ca+2
Preparation Note
Este produto foi liofilizado a partir de uma solução filtrada de 0,2 μm de solução salina de fosfato tamponada, em pH 7,4. Ele deve ser reconstituído adicionando o conteúdo do frasco a 1 mg/ml usando 10 mM de ácido acético. Para diluir concentrações mais baixas, mas não inferiores a 10 μg/ml, será necessário adicionar 0,1% de BSA ou HSA. Para uso em ensaios de proliferação, dilua adicionalmente a amostra com meio sem albumina.
Analysis Note
A atividade biológica deste produto é medida em um ensaio de proliferação usando células BALB/MK. A EC50 é definida como a concentração efetiva de fator de crescimento que provoca um aumento de 50% no crescimento celular em bioensaio à base de células.
Other Notes
O EGF humano (hEGF) é uma molécula idêntica à β-urogastrona, uma molécula isolada em função de sua capacidade de inibir a secreção gástrica de ácido. O EGF é estruturalmente homólogo ao fator de crescimento transformador-α humano, e ambos agem através de receptores de EGF. O E9644 é uma forma metionil N-terminal de EGF maduro natural.
Disclaimer
Este produto deve ser armazenado a -20 ºC e manterá sua atividade por dois anos. Após a reconstituição, ele pode ser armazenado a 2-8 °C por um mês, ou congelado em alíquotas a -70 °C ou -20 °C por períodos mais longos.
1 of 1
Este Item | |||
|---|---|---|---|
| biological source human | biological source human | biological source human | biological source mouse submaxillary glands |
| assay ≥97% (SDS-PAGE) | assay >97% (SDS-PAGE) | assay >95% (SDS-PAGE) | assay - |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant expressed in Baculovirus infected High-5 cells | recombinant - |
| technique(s) cell culture | mammalian: suitable | technique(s) - | technique(s) cell culture | mammalian: suitable | technique(s) cell culture | mammalian: suitable |
| Quality Level 300 | Quality Level 200 | Quality Level 200 | Quality Level 200 |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized powder |
Classe de armazenamento
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Protocolos
A stem cell culture protocol to generate 3D NSC models of Alzheimer’s disease using ReNcell human neural stem cell lines.
Step-by-step culture protocols for neural stem cell culture including NSC isolation, expansion, differentiation and characterization.
Artigos
Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com
Organoid culture products to generate tissue and stem cell derived 3D brain, intestinal, gut, lung and cancer tumor organoid models.
Human pancreatic cancer organoid biobank (PDAC organoids) with various KRAS mutations to aide in 3D cell culture and cancer research applications.
Conteúdo relacionado
Monitor barrier formation using colon PDOs, iPSC-derived colon organoids, Millicell® cell culture inserts, and the Millicell® ERS. 3.0.
Instructions
Anita Alexa et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(9), 2711-2716 (2015-03-03)
Mitogen-activated protein kinases (MAPKs) bind and activate their downstream kinase substrates, MAPK-activated protein kinases (MAPKAPKs). Notably, extracellular signal regulated kinase 2 (ERK2) phosphorylates ribosomal S6 kinase 1 (RSK1), which promotes cellular growth. Here, we determined the crystal structure of an
Piera Versura et al.
Investigative ophthalmology & visual science, 52(8), 5488-5496 (2011-04-19)
To investigate the immune response of human conjunctival epithelium to hyperosmolar stress. Tear osmolarity was measured in 15 normal subjects and 25 dry eye (DE) patients; conjunctival imprint cytology samples were obtained at the nasal bulbar area. Subconfluent primary human
Koji Teramoto et al.
Cellular signalling, 62, 109329-109329 (2019-06-04)
EphA2, which belongs to the Eph family of receptor tyrosine kinases, is overexpressed in a variety of human cancers. Serine 897 (S897) phosphorylation of EphA2 is known to promote cancer cell migration and proliferation in a ligand-independent manner. In this
Número de item de comércio global
| SKU | GTIN |
|---|---|
| E9644-.2MG | 04061838447111 |
| E9644-5X.2MG | 04061835568437 |
| E9644-.5MG | 04061838447128 |
-
what is the full peptide sequence of mature E9644 protein (~6kD)?
1 answer-
Helpful?
-
-
For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?
1 answer-
After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.
Helpful?
-
-
Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?
1 answer-
This product has been tested for activity using the mouse Balb/3T3 cell line. We have not tested its activity in rat cell culture, but we expect that will also work in that application.
Helpful?
-
-
Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
We recommend reconstitution with acetic acid to make sure the entire product will be solubilized. PBS can be used, but the total amount of the protein in the vial may not go into solution. It is best to make a higher concentration in acetic acid, and then dilute into PBS.
Helpful?
-
-
How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.
Helpful?
-
-
What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?
1 answer-
Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
The mature protein has a molecular weight of 6 kD.
Helpful?
-