HPA001429

Sigma-Aldrich

Anti-NBN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):
Anti-Nijmegen breakage syndrome protein 1, Anti-Nibrin, Anti-Cell cycle regulatory protein p95
Número do Atlas de Proteínas Humanas:

fonte biológica

rabbit

Nível de qualidade

100

forma do anticorpo

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

species reactivity

human

embalagem

antibody small pack of 25 μL

aplicação(ões)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL

conjugado

unconjugated

nº de adesão UniProt

enviado em

wet ice

temperatura de armazenamento

−20°C

Gene Information

human ... NBN(4683)

Categorias relacionadas

Descrição geral

NBN (nibrin) is a part of a highly conserved protein complex, which also includes MRE11 and RAD50 proteins. This complex is essential in recognition and signaling of DNA double-strand break (DSB). Functionally, this protein can be divided into two domains- C-terminal contains MRE11 (meiotic recombination 11 homolog A)- and ATM (ataxia telangiectasia-mutated) kinase-binding domains. Its N-terminal is responsible for phosphor-dependent protein-protein interactions and contains forkhead-associated (FHA) and breast cancer C-terminal (BRCT).

Imunogênio

Nibrin recombinant protein epitope signature tag (PrEST)

Aplicação

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Ações bioquímicas/fisiológicas

NBN (nibrin) is involved in DNA double-strand break repair. It activates DNA damage-induced checkpoint. Defects in this gene are associated with Nijmegen breakage syndrome that is characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. It plays a role in tumorigenesis, and this gene is mutated in breast and colorectal cancer, primary glioblastoms and medulloblastoma, acute lymphoblastic leukemia (ALL) and other lymphoid malignancies.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST78218.

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Alemanha

WGK 1

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificado de análise

Certificado de origem

Regina Waltes et al.
American journal of human genetics, 84(5), 605-616 (2009-05-05)
The MRE11/RAD50/NBN (MRN) complex plays a key role in recognizing and signaling DNA double-strand breaks (DSBs). Hypomorphic mutations in NBN (previously known as NBS1) and MRE11A give rise to the autosomal-recessive diseases Nijmegen breakage syndrome (NBS) and ataxia-telangiectasia-like disorder (ATLD)...
Naoyuki Hayashi et al.
Journal of biochemistry, 154(5), 429-435 (2013-08-07)
NBS1 is the causative gene product of Nijmegen breakage syndrome (NBS), a recessive genetic disorder resulting in chromosomal instability and immunodeficiency. We isolated DNMT1 cDNA by two-hybrid screening by using NBS1 as bait to study its function in DNA replication...
Kelvin Yin et al.
Molecular cancer research : MCR, 15(9), 1184-1196 (2017-06-14)
Exposure of melanocytes to ultraviolet radiation (UVR) induces the formation of UV lesions that can produce deleterious effects in genomic DNA. Encounters of replication forks with unrepaired UV lesions can lead to several complex phenomena, such as the formation of...
Philipp Seidel et al.
Oncotarget, 7(17), 23006-23018 (2016-04-07)
Nijmegen Breakage Syndrome is a disease caused by NBN mutations. Here, we report a novel function of Nbn in skin homeostasis. We found that Nbn deficiency in hair follicle (HF) progenitors promoted increased DNA damage signaling, stimulating p16Ink4a up-regulation, Trp53...
Åsa Ehlén et al.
Translational oncology, 4(4), 212-221 (2011-08-02)
The RNA-binding motif protein 3 (RBM3) was initially discovered as a putative cancer biomarker based on its differential expression in various cancer forms in the Human Protein Atlas (HPA). We previously reported an association between high expression of RBM3 and...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica