All Photos(2)
HPA036926
Anti-OPA1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
All Photos(2)
Synonym(s):
Anti-FLJ12460, Anti-KIAA0567, Anti-MGM1, Anti-NPG, Anti-NTG, Anti-Optic atrophy 1 (autosomal dominant)
Número do Atlas de Proteínas Humanas:
Recommended Products
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
species reactivity
human
embalagem
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sequência de imunogênio
ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
nº de adesão UniProt
enviado em
wet ice
temperatura de armazenamento
−20°C
Gene Information
human ... OPA1(4976)
Descrição geral
The OPA1 (optic atrophy type 1) gene has been mapped to human chromosome 3q28–q29. This nuclear gene encodes a mitochondria-localized, dynamin-related protein. It contains a highly basic amino-terminal domain that assists in mitochondrial localization. The gene spans a length of 69kb and contains 29 exons. It is broadly expressed with highest expression in the retina.
Imunogênio
optic atrophy 1 (autosomal dominant) recombinant protein epitope signature tag (PrEST)
Embalagem
25, 100 μL
Aplicação
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Ações bioquímicas/fisiológicas
The OPA1 (optic atrophy type 1) gene encodes a large GTPase that may function in mitochondrial biogenesis and may stabilize the integrity of mitochondrial membrane. Mutations in this gene have been associated with ADOA (autosomal dominant optic atrophy), highly prevalent hereditary optic neuropathy, which is characterized by progressive loss of visual acuity, centrocoecal scotoma and bilateral temporal atrophy of the optic nerve. The disease is usually seen to surface within the first two decades of life.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST79535.
forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informações legais
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Código de classe de armazenamento
10 - Combustible liquids
WGK
WGK 1
Ponto de fulgor (ºF)
Not applicable
Ponto de fulgor (ºC)
Not applicable
Certificate of Analysis
Enter Lot Number to search for Certificate of Analysis (COA).
Certificate of Origin
Enter Lot Number to search for Certificate of Origin (COO).
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service