Todas as fotos(4)

HPA039980

Sigma-Aldrich

Anti-NRP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):
Anti-Vegf165r2, Anti-Neuropilin 2
Número MDL:
Número do Atlas de Proteínas Humanas:

fonte biológica

rabbit

Nível de qualidade

100

forma do anticorpo

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

species reactivity

human

embalagem

antibody small pack of 25 μL

aplicação(ões)

immunohistochemistry: 1:500-1:1000

sequência de imunogênio

LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL

conjugado

unconjugated

nº de adesão UniProt

enviado em

wet ice

temperatura de armazenamento

−20°C

Gene Information

human ... NRP2(8828)

Descrição geral

The gene NRP2 (neuropilin 2) is mapped to human chromosome 2q33. The gene encodes a single-spanning transmembrane glycoprotein. It belongs to the NRP class of proteins. The protein has two CUB (complement C1r/C1s, Uegf, Bmp1) domains, two F5/8 domains, a MAM (meprin/A5 protein/receptor protein tyrosine phosphatase μ) domain and a transmembrane region.

Imunogênio

neuropilin 2 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

NRPs (neuropilins) mainly interact with vascular endothelial growth factor (VEGF) receptors, class 3 semaphorins and other receptors. Absence of NRP2 in mice shows mild phenotypic effects in lymphatic system development and axon guidance. NRP2 is also expressed in various cancers and is associated with the proliferation, survival and migration of cancer cells. NRP2 interaction with SEMA3F (semaphorin 3F) reduces PI-3K (phosphoinositide 3 kinase) activity, mTORC2 (mammalian target of rapamycin complex 2)-associated signaling, RhoA (Ras homolog gene family, member A) activity and suppresses the making of cytoskeletal stress fibers.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST78075.

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Alemanha

WGK 1

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise

Certificado de origem

Triggers for autism: genetic and environmental factors.
Matsuzaki H, et al.
Journal of Central Nervous System Disease, 4, 27-36 (2012)
Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
Bhide GP, et al.
The Journal of Biological Chemistry, 291, 9444-9457 (2016)
Concurrent Expression of VEGF-C and Neuropilin-2 Is Correlated with Poor Prognosis in Glioblastoma.
Zhao H, et al.
The Tohoku Journal of Experimental Medicine, 238, 85-91 (2016)
Evalynn Vasquez et al.
JCI insight, 2(3), e90617-e90617 (2017-02-15)
Chronic urethral obstruction and the ensuing bladder wall remodeling can lead to diminished bladder smooth muscle (BSM) contractility and debilitating lower urinary tract symptoms. No effective pharmacotherapy exists to restore BSM contractile function. Neuropilin 2 (Nrp2) is a transmembrane protein...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica