Merck
All Photos(4)

S9697

Sigma-Aldrich

Superoxide Dismutase bovine

recombinant, expressed in E. coli, lyophilized powder, ≥2500 units/mg protein, ≥90% (SDS-PAGE)

Synonym(s):
Superoxide Dismutase 1 bovine, CU/ZN-SOD, SOD, SOD1, Superoxide: superoxide oxidoreductase
CAS Number:
Enzyme Commission number:
Número EC:
Número MDL:
NACRES:
NA.54

recombinante

expressed in E. coli

Nível de qualidade

200

teor

≥90% (SDS-PAGE)

forma

lyophilized powder

specific activity

≥2500 units/mg protein

pH ideal

7.8 (25 °C)

pH range

7.6-10.5

pI 

4.95

observação sobre a sequência

MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK

nº de adesão NCBI

temperatura de armazenamento

−20°C

Descrição geral

SOD from bovine erythrocytes was the first SOD to be found in mammalian tissues. Before its enzymatic activity was discovered the protein was known as haemocuprein or erythrocuprein. SOD from bovine erythrocytes is a homodimeric non-covalently bound protein with two 16.3 kDa subunits of 151 amino acids. Each monomer has one intrachain disulfide and one free sulfhydryl, one Cu+2 atoms and one Zn+2 atoms. There are three forms of SOD differentiated by the metal ions in the active site. These are Cu+2/Zn+2, Mn+2, and Fe+2 SOD. In vertebrate organisms Cu/Zn-SOD is found in the cytoplasm and the mitochondrial intermembrane space, while Mn-SOD is found in the mitochondrial matrix space. Fe-SOD is found in prokaryotes and some higher plants.

Aplicação

Superoxide dismutase has been used in a study to investigate where lipoproteins may affect the L-arginine-nitric oxide pathway. Superoxide dismutase has also been used in a study to investigate the mass spectral evidence for carbonate-anion-radical-induced posttranslational modification of tryptophan to kynurenine in human Cu, Zn superoxide dismutase.
The product has been used to develop an SOD assay. This assay used dismutase-mediated inhibition of NADH-dependent nitroblue tetrazolium reduction.

Embalagem

15000 units in glass bottle
30000, 75000, 300000 units in poly bottle

Ações bioquímicas/fisiológicas

Superoxide dismutase (SOD) catalyzes the dismutation of superoxide radicals to hydrogen peroxide and molecular oxygen. SOD plays a critical role in the defense of cells against the toxic effects of oxygen radicals. SOD competes with nitric oxide (NO) for superoxide anion (which reacts with NO to form peroxynitrite), thereby SOD promotes the activity of NO. SOD has also been shown to suppress apoptosis in cultured rat ovarian follicles, neural cell lines, and transgenic mice by preventing the conversion of NO to peroxynitrate, an inducer of apoptosis.

Definição da unidade

One unit will inhibit reduction of cytochrome c by 50% in a coupled system with xanthine oxidase at pH 7.8 at 25°C in a 3.0 ml reaction volume. Xanthine oxidase concentration should produce an initial ΔA550 of 0.025 ± 0.005 per min.

Nota de preparo

Produced using animal component-free materials.

Reconstituição

Reconstitute in 10 mM potassium phosphate, pH 7.4.

Nota de análise

Extinction coefficient: EmM= 10.3 (258 nM)
SOD has no significant absorbance peak at 280 nM because of the absence of tryptophan.

Outras notas

Inhibitors: cyanide, OH- (competitive), hydrogen peroxide

Código de classe de armazenamento

10 - Combustible liquids

WGK

WGK 3

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

More Documents

SDS

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service