SAB1409759

Monoclonal Anti-TM4SF4 antibody produced in mouse

clone 4E6, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ31015, ILTMP, il-TMP
• NACRES: NA.41

Properties

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4E6, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 47.8 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_004617.2
• nº de adesão UniProt: P48230
• enviado em: dry ice
• temperatura de armazenamento: −20°C
• Gene Information: human ... TM4SF4(7104)

Description

Descrição geral

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene. (provided by RefSeq)

Imunogênio

TM4SF4 (NP_004608.1, 1 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV

Embalagem

100 μg

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• WGK: WGK 3
• Ponto de fulgor (ºF): Not applicable
• Ponto de fulgor (ºC): Not applicable