SAB2106161

Anti-MFN1 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-DKFZp762F247, Anti-FLJ20693, Anti-MGC41806, Anti-hfzo1, Anti-hfzo2
• NACRES: NA.41

Properties

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 84 kDa
• species reactivity: rabbit, rat, bovine, dog, mouse, human
• concentração: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• nº de adesão NCBI: NM_033540
• nº de adesão UniProt: Q8IWA4
• enviado em: wet ice
• temperatura de armazenamento: −20°C
• Gene Information: human ... MFN1(55669)

Description

Imunogênio

Synthetic peptide directed towards the middle region of human MFN1

Embalagem

100 μL

50 μg

Sequência

Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• WGK: WGK 3
• Ponto de fulgor (ºF): Not applicable
• Ponto de fulgor (ºC): Not applicable