All Photos(3)
SAB2109138
Anti-CD63 (C-terminal) antibody produced in rabbit
affinity isolated antibody
All Photos(3)
Synonym(s):
LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Recommended Products
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
26 kDa
species reactivity
mouse
species reactivity (predicted by homology)
human
concentração
0.5 mg/mL
technique(s)
western blot: 1 μg/mL
nº de adesão NCBI
enviado em
wet ice
temperatura de armazenamento
−20°C
Gene Information
human ... CD63(57396)
Descrição geral
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene.
Embalagem
100 μL
Sequência
Synthetic peptide located within the following region: TDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRK
forma física
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Código de classe de armazenamento
10 - Combustible liquids
WGK
nwg
Ponto de fulgor (ºF)
Not applicable
Ponto de fulgor (ºC)
Not applicable
Certificate of Analysis
Enter Lot Number to search for Certificate of Analysis (COA).
Certificate of Origin
Enter Lot Number to search for Certificate of Origin (COO).
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service