WH0005957M1

Sigma-Aldrich

Monoclonal Anti-RCV1 antibody produced in mouse

clone 4C6, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):
Anti-recoverin
NACRES:
NA.41

Nível de qualidade

100

fonte biológica

mouse

forma do anticorpo

purified immunoglobulin

antibody product type

primary antibodies

clone

4C6, monoclonal

forma

buffered aqueous solution

species reactivity

human

aplicação(ões)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

conjugado

unconjugated

GenBank® accession no.

nº de adesão UniProt

enviado em

dry ice

temperatura de armazenamento

−20°C

Gene Information

human ... RCVRN(5957)

Descrição geral

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. (provided by RefSeq)

Imunogênio

RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise
Certificado de origem
Thai-Yen Ling et al.
Biomaterials, 35(22), 5660-5669 (2014-04-22)
The inability to adequately vascularize tissues in vitro or in vivo is a major challenge in lung tissue engineering. A method that integrates stem cell research with 3D-scaffold engineering may provide a solution. We have successfully isolated mouse pulmonary stem/progenitor cells (mPSCs)...
M N Garas et al.
Acta naturae, 6(2), 95-105 (2014-08-06)
Current targeting strategies for genetic vectors imply the creation of a specific vector for every targeted receptor, which is time-consuming and expensive. Therefore, the development of a universal vector system whose surface can specifically bind molecules to provide efficient targeting...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica

Redes sociais

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Pesquisa. Desenvolvimento. Produção.

Somos um fornecedor global líder para o setor de ciências biológicas, com soluções e serviços para pesquisa, desenvolvimento e produção de biotecnologia, além de produção e desenvolvimento de terapias farmacológicas com medicamentos.

© 2021 Merck KGaA, Darmstadt, Alemanha e/ou suas filiais. Todos os direitos reservados.

A reprodução não autorizada de quaisquer materiais deste site é estritamente proibida.