WH0007038M1

Sigma-Aldrich

Monoclonal Anti-TG antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):
Anti-thyroglobulin, Anti-AITD3
Número MDL:
NACRES:
NA.41

Nível de qualidade

100

fonte biológica

mouse

forma do anticorpo

purified immunoglobulin

antibody product type

primary antibodies

clone

1G3, monoclonal

forma

buffered aqueous solution

species reactivity

human

aplicação(ões)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

conjugado

unconjugated

GenBank® accession no.

nº de adesão UniProt

enviado em

dry ice

temperatura de armazenamento

−20°C

Gene Information

human ... TG(7038)

Descrição geral

Thyroglobulin (TG) is a 660 kDa homodimeric glycoprotein, secreted by endoplasmic reticulum. The gene is located on human chromosome 8q24.22. It is majorly expressed in thyroid gland.

Imunogênio

TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Ações bioquímicas/fisiológicas

Thyroglobulin (TG) regulates iodide storage and synthesis of thyroid hormones, thyroxine (T4) and triiodothyronine (T3). Mutations in TG is associated with goiter and congenital hypothyroidism. Polymorphisms in this gene is linked to autoimmune thyroid diseases (AITD) like, Graves′ disease and Hashimoto thyroiditis.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise
Certificado de origem
Novel mutational mechanism in the thyroglobulin gene: imperfect DNA inversion as a cause for hereditary hypothyroidism
Citterio CE, et al.
Molecular and Cellular Endocrinology, 381(1-2), 220-229 (2013)
Thyroglobulin gene mutations in Chinese patients with congenital hypothyroidism
Hu X, et al.
Molecular and Cellular Endocrinology, 423, 60-66 (2016)
Thyroglobulin from molecular and cellular biology to clinical endocrinology
Di JB and Arvan P
Endocrine Reviews, 37(1), 2-36 (2015)
Association of the polymorphisms in the gene encoding thyroglobulin with the development and prognosis of autoimmune thyroid disease
Mizuma T, et al.
Autoimmunity, 50(6), 386-392 (2017)
Stephanie Smooke-Praw et al.
Clinical endocrinology, 81(2), 271-275 (2014-02-06)
Thyroglobulin antibodies (TgAb) are present in approximately 20% of patients with papillary thyroid cancer (PTC) and invalidate the serum thyroglobulin (Tg) level as a tumour marker. We examined whether trends in the TgAb level could serve as a surrogate marker...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica

Redes sociais

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Pesquisa. Desenvolvimento. Produção.

Somos um fornecedor global líder para o setor de ciências biológicas, com soluções e serviços para pesquisa, desenvolvimento e produção de biotecnologia, além de produção e desenvolvimento de terapias farmacológicas com medicamentos.

© 2021 Merck KGaA, Darmstadt, Alemanha e/ou suas filiais. Todos os direitos reservados.

A reprodução não autorizada de quaisquer materiais deste site é estritamente proibida.