WH0007486M9

Sigma-Aldrich

Monoclonal Anti-WRN antibody produced in mouse

clone 3C11, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):
Anti-RECQL3, Anti-RECQL2, Anti-RECQ3, Anti-Werner syndrome
Número MDL:
NACRES:
NA.41

Nível de qualidade

100

fonte biológica

mouse

forma do anticorpo

purified immunoglobulin

antibody product type

primary antibodies

clone

3C11, monoclonal

forma

buffered aqueous solution

species reactivity

rat, mouse, human

aplicação(ões)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

conjugado

unconjugated

GenBank® accession no.

nº de adesão UniProt

enviado em

dry ice

temperatura de armazenamento

−20°C

Gene Information

human ... WRN(7486)

Descrição geral

This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3′ to 5′ DNA helicase activity, and is also a 3′ to 5′ exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging. (provided by RefSeq)

Imunogênio

WRN (NP_000544, 1322 a.a. ~ 1432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificado de análise

Certificado de origem

Bárbara Alcaraz Silva et al.
The Journal of biological chemistry, 289(33), 22771-22784 (2014-07-02)
Chromosome ends contain nucleoprotein structures known as telomeres. Damage to chromosome ends during interphase elicits a DNA damage response (DDR) resulting in cell cycle arrest. However, little is known regarding the signaling from damaged chromosome ends (designated here as "TIPs")...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica