WH0025824M1

Sigma-Aldrich

Monoclonal Anti-PRDX5 antibody produced in mouse

clone 3E6, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):
Anti-PRXV, Anti-SBBI10, Anti-MGC117264, Anti-ACR1, Anti-B166, Anti-PLP, Anti-PMP20, Anti-AOEB166, Anti-PRDX6, Anti-peroxiredoxin 5
Número MDL:
NACRES:
NA.41

Nível de qualidade

100

fonte biológica

mouse

forma do anticorpo

purified immunoglobulin

antibody product type

primary antibodies

clone

3E6, monoclonal

forma

buffered aqueous solution

species reactivity

human

aplicação(ões)

indirect ELISA: suitable

Isotipo

IgG2aκ

conjugado

unconjugated

GenBank® accession no.

nº de adesão UniProt

enviado em

dry ice

temperatura de armazenamento

−20°C

Gene Information

human ... PRDX5(25824)

Descrição geral

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Imunogênio

PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise
Certificado de origem
C McDonald et al.
International journal of oncology, 45(1), 219-226 (2014-05-03)
Peroxiredoxin (Prdx) proteins are thiol-specific antioxidants that protect cells from oxidative stress in many normal and disease states. There are six Prdx proteins expressed in mammals, each with a characteristic tissue expression, subcellular distribution and substrate specificity. Recent studies have...

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica

Redes sociais

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Pesquisa. Desenvolvimento. Produção.

Somos um fornecedor global líder para o setor de ciências biológicas, com soluções e serviços para pesquisa, desenvolvimento e produção de biotecnologia, além de produção e desenvolvimento de terapias farmacológicas com medicamentos.

© 2021 Merck KGaA, Darmstadt, Alemanha e/ou suas filiais. Todos os direitos reservados.

A reprodução não autorizada de quaisquer materiais deste site é estritamente proibida.