WH0079845M1

Sigma-Aldrich

Monoclonal Anti-RNF122 antibody produced in mouse

clone 5E5, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):
Anti-MGC126622, Anti-FLJ12526, Anti-ring finger protein 122
NACRES:
NA.41

Nível de qualidade

100

fonte biológica

mouse

forma do anticorpo

purified immunoglobulin

antibody product type

primary antibodies

clone

5E5, monoclonal

forma

buffered aqueous solution

species reactivity

human

aplicação(ões)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

conjugado

unconjugated

GenBank® accession no.

nº de adesão UniProt

enviado em

dry ice

temperatura de armazenamento

−20°C

Gene Information

human ... RNF122(79845)

Descrição geral

The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. (provided by RefSeq)

Imunogênio

RNF122 (NP_079063, 61 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Alemanha

nwg

Ponto de fulgor (ºF)

Not applicable

Ponto de fulgor (ºC)

Not applicable

Certificado de análise
Certificado de origem

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica

Redes sociais

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Pesquisa. Desenvolvimento. Produção.

Somos um fornecedor global líder para o setor de ciências biológicas, com soluções e serviços para pesquisa, desenvolvimento e produção de biotecnologia, além de produção e desenvolvimento de terapias farmacológicas com medicamentos.

© 2021 Merck KGaA, Darmstadt, Alemanha e/ou suas filiais. Todos os direitos reservados.

A reprodução não autorizada de quaisquer materiais deste site é estritamente proibida.