MSQC18

SILu^™Lite SigmaMAb Cetuximab Monoclonal Antibody

Name: SILu<SUP>™</SUP>Lite SigmaMAb Cetuximab Monoclonal Antibody
Brand: SIGMA
Price: 576 CAD

recombinant, expressed in CHO cells

Synonym(s):

Mass spectrometry standard, Cetuximab

Slide 1 of 2

Select a Size

0.5 MG

$576.00

Please contact Customer Service for Availability

Request a Bulk Order

About This Item

NACRES:

NA.41

UNSPSC Code:

41105331

Clone:

Species reactivity:

Application:

—

Citations:

Key Documents

View All Documentation

recombinant

expressed in CHO cells

assay

≥90% (SDS-PAGE)

form

solid

suitability

suitable for mass spectrometry

shipped in

wet ice

storage temp.

−20°C

Related Categories

Protein Mass Spectrometry

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	MSQC20	MSQC28	MSQC26
Sigma-Aldrich MSQC18 SILu^™Lite SigmaMAb Cetuximab Monoclonal Antibody	Sigma-Aldrich MSQC20 SILu^™Lite SigmaMAb Bevacizumab Monoclonal Antibody	Sigma-Aldrich MSQC28 SILu^™Lite SigmaMAb Vedolizumab Monoclonal Antibody	Sigma-Aldrich MSQC26 SILu^™Lite SigmaMAb Nivolumab Monoclonal Antibody
form solid	form solid	form solid	form solid
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C
shipped in wet ice	shipped in wet ice	shipped in wet ice	shipped in wet ice
recombinant expressed in CHO cells	recombinant expressed in CHO cells	recombinant expressed in CHO cells	recombinant expressed in CHO cells
assay ≥90% (SDS-PAGE)	assay ≥90% (SDS-PAGE)	assay ≥90% (HPLC)	assay ≥90% (HPLC)
suitability suitable for mass spectrometry	suitability suitable for mass spectrometry	suitability suitable for mass spectrometry	suitability suitable for mass spectrometry

General description

SigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu^™Mab Cetuximab (MSQC19).

SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.

Application

SILu^™ Lite SigmaMAb Cetuximab Monoclonal Antibody has been used in isoluminol enhanced chemiluminescence assay to measure the reactive oxygen species (ROS) production from monocytes.

Other Notes

SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

0000501199

0000484493

0000265873

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

EGFR-RAS-MAPK signaling is confined to the plasma membrane and associated endorecycling protrusions.

Sachin Surve et al.

The Journal of cell biology, 220(11) (2021-09-14)

The subcellular localization of RAS GTPases defines the operational compartment of the EGFR-ERK1/2 signaling pathway within cells. Hence, we used live-cell imaging to demonstrate that endogenous KRAS and NRAS tagged with mNeonGreen are predominantly localized to the plasma membrane. NRAS

Idelalisib Rescues Natural Killer Cells from Monocyte-Induced Immunosuppression by Inhibiting NOX2-Derived Reactive Oxygen Species.

Ali A Akhiani et al.

Cancer immunology research, 8(12), 1532-1541 (2020-09-25)

The phosphatidylinositol-4,5-bisphosphate-3 kinase-δ (PI3Kδ) inhibitor idelalisib, used alone or in combination with anti-CD20, is clinically efficacious in B-cell lymphoma and chronic lymphocytic leukemia (CLL) by promoting apoptosis of malignant B cells. PI3K regulates the formation of reactive oxygen species (ROS)

Articles

Antibody Aggregates & Fragments Analysis Workflow

Characterize mAb monomers, aggregates, and fragments using SEC-UV workflow with Zenix^® and Zenix^®-C SEC columns.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

SILu^™Lite SigmaMAb Cetuximab Monoclonal Antibody