Search Within
Product Category
Brand
Biological Source
Color
Formula Weight
Gene Alias
Physical Form
Purity
Chemical Composition
Quality Segment
Technique
Available for Sale
h-gly-arg-gly-asp-ser
Applied Filters:
Keyword:'h-gly-arg-gly-asp-ser'
Showing 1-30 of 135 results for "h-gly-arg-gly-asp-ser" within Products
All Photos(2)
H-Gly-Arg-Gly-Asp-Ser-Pro-OH
Synonym(s): H-Gly-Arg-Gly-Asp-Ser-Pro-OH
Empirical Formula (Hill Notation): C22H37N9O10
- Molecular Weight:
- 587.58
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
03-34-0035 | Shown to inhibit fibronectin binding to platelet-binding sites. | |||
All Photos(1)
H-Gly-Arg-Ala-Asp-Ser-Pro-OH
Synonym(s): H-Gly-Arg-Ala-Asp-Ser-Pro-OH
Empirical Formula (Hill Notation): C23H39N9O10
- Molecular Weight:
- 601.61
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
03-34-0052 | Inactive control peptide for other fibronectin inhibitors. | |||
All Photos(1)
H-Arg-Gly-Asp-Ser-OH
Synonym(s): H-Arg-Gly-Asp-Ser-OH
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
03-34-0002 | ||||
All Photos(1)
Ser-Asp-Gly-Arg-Gly
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
S3771 | ≥90% (HPLC) | |||
All Photos(1)
Gly-Arg-Gly-Asp-Ser
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
G4391 | ≥97% (HPLC) | |||
All Photos(1)
Arg-Gly-Asp-Ser
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
A9041 | ≥95% (HPLC) | |||
All Photos(1)
Gly-Arg-Gly-Asp-Ser-Pro-Lys
Synonym(s): GRGDSPK
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
G1269 | ≥97% (HPLC) | |||
All Photos(1)
Gly-Arg-Gly-Asp-Ser-Pro (GRGDSP)
Empirical Formula (Hill Notation): C22H37N9O10
- Molecular Weight:
- 587.58
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0157 | ||||
All Photos(1)
Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-Pro
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
A6677 | ≥97% (HPLC) | |||
All Photos(1)
Gly-Arg-Ala-Asp-Ser-Pro (GRADSP)
Empirical Formula (Hill Notation): C23H39N9O10
- Molecular Weight:
- 601.61
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0156 | ||||
All Photos(1)
Tyr-C-Peptide human
Synonym(s): Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg, Tyr-Insulin C chain
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
C9781 | ≥95% (HPLC) | |||
All Photos(1)
L-BNP trifluoroacetate salt
Synonym(s): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Leu-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His [Disulfide Bridge: 10-26] trifluoroacetate salt, [Leu13]-BNP trifluoroacetate salt, [Leu13]-Brain Natriuretic Peptide-32 trifluoroacetate salt
Empirical Formula (Hill Notation): C143H243N47O42S4 · xC2HF3O2
- Molecular Weight:
- 3421.01 (free base basis)
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
B7313 | ≥98% (HPLC) | |||
All Photos(1)
Copeptin trifluoroacetate human
Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
- CAS No.:
- 78362-34-2
- Molecular Weight:
- 4021.40 (free base basis)
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
C8749 | ≥95% (HPLC) | |||
All Photos(1)
Liraglutide
Synonym(s): Arg34, Lys26-[Nε(γ-Glu[Nα-hexadecanoyl])]-GLP-1[7-37], H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]-Lys-α-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH, HAEGTFTSDVSSYLEGQAA-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]K-EFIAWLVRGRG, NN2211
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML3925 | ≥95% (HPLC) | |||
All Photos(1)
Nrf2 Activator III, TAT-14 Peptide
Synonym(s): Nrf2 Activator III, TAT-14 Peptide
All Photos(1)
Tat-NR2B9c trifluoroacetate
Synonym(s): NA-1, trifluoroacetate salt, Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Lys-Leu-Ser-Ser-Ile-Glu-Ser-Asp-Val, trifluoroacetate salt, YGRKKRRQRRR-KLSSIESDV, trifluoroacetate salt
Empirical Formula (Hill Notation): C105H188N42O30 · xC2HF3O2
- CAS No.:
- 500992-11-0
- Molecular Weight:
- 2518.88 (free base basis)
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML2988 | ≥95% (HPLC) | |||
All Photos(1)
Lixisenatide
Synonym(s): (Des-Pro38)-Exendin-4-(Lys)6 amide, AVE0010, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2, ZP10, ZP10A
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML2836 | ≥95% (HPLC) | |||
All Photos(1)
Hepcidin-25 (human) trifluoroacetate salt
Synonym(s): DTHFPICIFCCGCCHRSKCGMCCKT trifluoroacetate salt, H-Asp-Thr-His-Phe-Pro-Ile-Cys-Ile-Phe-Cys-Cys-Gly-Cys-Cys-His-Arg-Ser-Lys-Cys-Gly-Met-Cys-Cys-Lys-Thr-OH trifluoroacetate salt, Hepc25 (human), LEAP-1 (Liver-Expressed Antimicrobial Peptide) (human) trifluoroacetate salt, PLTR (Putative Liver Tumor Regressor ) (human)
Empirical Formula (Hill Notation): C113H170N34O31S9 · xC2HF3O2
- CAS No.:
- 342809-17-0
- Molecular Weight:
- 2789.35 (free base basis)
Compare | Product No. | Description | Pricing | |
---|---|---|---|---|
SML1118 | ≥95% (HPLC) | |||
All Photos(1)
Peptide YY porcine
Synonym(s): PYY, Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Compare | Product No. | Description | Pricing | |
---|---|---|---|---|
P5801 | ≥97% (HPLC), synthetic | |||
All Photos(1)
CIGB-300 trifluoroacetate
Synonym(s): CIGB-325 trifluoroacetate, H-GRKKRRQRRRPPQ-βA-CWMSPRHLGTC-NH2 trifluoroacetate (βA = β-alanine; C15-C25 disulfide), H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Gln-βAla-Cys-Trp-Met-Ser-Pro-Arg-His-Leu-Gly-Thr-Cys-NH2 trifluoroacetate (Cys15-Cys25 disulfide), P15-Tat trifluoroacetate
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML3143 | ≥95% (HPLC) | |||
All Photos(1)
Peptide YY human
Synonym(s): PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
P1306 | ≥97% (HPLC), synthetic | |||
All Photos(1)
Hypercalcemia of malignancy factor 1-40 human
Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser, PTH-Like Adenylate Cyclase Stimulating Protein, PTHrP (1-40), Parathyroid hormone-related protein (1-40)
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
H4644 | ≥95% (HPLC), suitable fo drug transporter assays | |||
All Photos(1)
Hypercalcemia of malignancy factor fragment 1-34 amide human
Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
H9148 | ≥97% (HPLC) | |||
All Photos(1)
FR-1, cyclic
Empirical Formula (Hill Notation): C35H57N13O16S2
- Molecular Weight:
- 980.03
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0147 | ||||
All Photos(1)
Teduglutide trifluoroacetate
Synonym(s): ALX 0600, TFA salt, ALX-0600, TFA salt, ALX0600, TFA salt, HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, TFA salt, His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp, TFA salt, [Gly2]-GLP-2 (human), TFA salt, [Gly2]-Glucagon-like peptide II (human), TFA salt, [Gly2]GLP-2 (human), TFA salt
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML3264 | ≥95% (HPLC) | |||
All Photos(1)
Taspoglutide trifluoroacetate salt
Synonym(s): 8-(2-Methylalanine)-35-(2-methylalanine)-36-L-argininamide-7-36-glucagon-like peptide I (human) trifluoroacetate salt, BIM 51077 trifluoroacetate salt, R1583 trifluoroacetate salt, RO 5073031 trifluoroacetate salt, [Aib8,35]hGLP-1(7-36)NH2; H-His-2-methyl-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-2-methyl-Ala-Arg-CONH2 trifluoroacetate salt
Empirical Formula (Hill Notation): C152H232N40O45 · xC2HF3O2
- CAS No.:
- 275371-94-3
- Molecular Weight:
- 3339.71 (free base basis)
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SML2260 | ≥95% (HPLC) | |||
All Photos(1)
SNP-1 Peptide
Empirical Formula (Hill Notation): C79H124N24O24
- Molecular Weight:
- 1793.98
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0239 | ≥95% (HPLC), lyophilized | |||
All Photos(1)
KISS Peptide
Empirical Formula (Hill Notation): C88H124N24O22
- Molecular Weight:
- 1870.07
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0172 | ≥95% (HPLC), lyophilized powder | |||
All Photos(1)
Fibrinopeptide B human
Empirical Formula (Hill Notation): C66H93N19O25
- Molecular Weight:
- 1552.56
Compare | Product No. | Description | Pricing | |
---|---|---|---|---|
SCP0145 | ||||
All Photos(1)
ANP [Des18-22] 4-23 Amide rat
Empirical Formula (Hill Notation): C64H107N25O19S2
- Molecular Weight:
- 1594.82
Compare | Product No. | Description | SDS | Pricing |
---|---|---|---|---|
SCP0022 | ||||
Page 1 of 5