Merck
All Photos(1)

SAB1401549

Sigma-Aldrich

Monoclonal Anti-RAB40B antibody produced in mouse

clone 1A1, ascites fluid

Synonym(s):
SEC4L, FLJ42385, RAR
NACRES:
NA.41

Quality Level

biological source

mouse

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

1A1, monoclonal

species reactivity

human

technique(s)

capture ELISA: suitable

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... RAB40B(10966)

General description

The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. (provided by RefSeq)

Immunogen

RAB40B (AAH18039, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS

Physical form

Clear solution

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service