Merck
Search Within
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
Manufacturer
Melting Point (°C)
Physical Form
pK Value
Product Line
Purity
Agency
Format
Analyte Suitability
Quality Segment
Application
Markush Class
Markush Group
Package Size
Amino Acid
API Family
Reference Material Type
Special Grade
Technique
Available for Sale

200-272-2

Applied Filters:
Keyword:'200-272-2'
Showing 1-30 of 33 results for "200-272-2" within Products
All Photos(18)

Synonym(s): Aminoacetic acid, Aminoethanoic acid, Glycocoll
Linear Formula: NH2CH2COOH
CAS No.:
56-40-6
Molecular Weight:
75.07
EC No.:
200-272-2
Beilstein No.:
635782
All Photos(1)

Glycine

EC No.:
200-272-2
CompareProduct No.DescriptionSDSPricing
GE17-1323-01Cytiva 17-1323-01, pack of 500 g
All Photos(1)

1-Naphthylammonium chloride

Synonym(s): 1-Naphthylammonium chloride
Empirical Formula (Hill Notation): C10H10ClN
CAS No.:
552-46-5
Molecular Weight:
179.65
CompareProduct No.DescriptionSDSPricing
8.20866for synthesis
All Photos(2)

Anti-AMPD3 antibody produced in rabbit

Synonym(s): Anti-adenosine monophosphate deaminase 3
CompareProduct No.ClonalityApplicationSpecies ReactivityCitationsSDS
HPA047408polyclonalIF, IHChuman
All Photos(1)

Cyclododecanol

Synonym(s): Cyclododecanol
Empirical Formula (Hill Notation): C12H24O
CAS No.:
1724-39-6
Molecular Weight:
184.32
CompareProduct No.DescriptionSDSPricing
8.02675for synthesis
All Photos(1)

Ethylenediaminetetraacetic acid dipotassium salt dihydrate

Synonym(s): Ethylenediaminetetraacetic acid dipotassium salt dihydrate
Empirical Formula (Hill Notation): C10H14K2N2O8 · 2H2O
CAS No.:
25102-12-9
Molecular Weight:
404.45
CompareProduct No.DescriptionSDSPricing
8.19040for synthesis
All Photos(1)

Tetraethylene glycol dimethyl ether

Synonym(s): Tetraethylene glycol dimethyl ether
Linear Formula: CH3O(CH2CH2O)4CH3
CAS No.:
143-24-8
Molecular Weight:
222.28
CompareProduct No.DescriptionSDSPricing
8.20959for synthesis
All Photos(1)

Minoxidil

Synonym(s): Minoxidil, 6-(1-Piperidinyl)-2,4-pyrimidinediamine 3-oxide, 6-(1-Piperidinyl)pyrimidine-2,4-diamine 3-oxide
Empirical Formula (Hill Notation): C9H15N5O
CAS No.:
38304-91-5
Molecular Weight:
209.25
CompareProduct No.DescriptionSDSPricing
PHR2123Pharmaceutical Secondary Standard; Certified Reference Material
All Photos(13)

Anti-Integrin αV Antibody, clone 272-17E6 ZooMAb® Mouse Monoclonal

CompareProduct No.ClonalityApplicationSpecies ReactivityCitationsSDS
ZMS1053monoclonal
recombinant monoclonal
FACS, ICC, IHC (p)humanenhanced validationgreener alternative
All Photos(1)

L-Pipecolic acid

Synonym(s): (S)-(−)-2-Piperidinecarboxylic acid, L-Homoproline
Empirical Formula (Hill Notation): C6H11NO2
CAS No.:
3105-95-1
Molecular Weight:
129.16
EC No.:
221-462-1
Beilstein No.:
81093
CompareProduct No.DescriptionSDSPricing
P251999% (titration)
All Photos(1)

Ethyl laurate

Synonym(s): Ethyl laurate
Linear Formula: CH3(CH2)10COOC2H5
CAS No.:
106-33-2
Molecular Weight:
228.37
CompareProduct No.DescriptionSDSPricing
8.05334for synthesis
All Photos(1)

Triisobutyl phosphate

Synonym(s): Triisobutyl phosphate
Linear Formula: ((CH3)2CHCH2)3PO
CAS No.:
126-71-6
Molecular Weight:
266.31
CompareProduct No.DescriptionSDSPricing
8.18606for synthesis
All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
CompareProduct No.DescriptionSDSPricing
N5017≥95% (HPLC), powder, synthetic
05-23-2005A potent vasoconstrictor.
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Copeptin trifluoroacetate human

Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
CAS No.:
78362-34-2
Molecular Weight:
4021.40 (free base basis)
CompareProduct No.DescriptionSDSPricing
C8749≥95% (HPLC)
All Photos(1)

Diabetes Associated Peptide Amide human

Synonym(s): Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide
Empirical Formula (Hill Notation): C165H261N51O55S2
CAS No.:
122384-88-7
Molecular Weight:
3903.28
CompareProduct No.DescriptionSDSPricing
D2162≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Parathyroid Hormone Fragment 1-34 human

Synonym(s): PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
P3796≥95% (HPLC), powder
All Photos(1)

Margatoxin

Synonym(s): MgTx
Empirical Formula (Hill Notation): C178H286N52O50S7
CAS No.:
145808-47-5
Molecular Weight:
4178.95
CompareProduct No.DescriptionSDSPricing
M8278
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Hypercalcemia of malignancy factor fragment 1-34 amide human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide
Empirical Formula (Hill Notation): C180H288N58O47
CAS No.:
112955-31-4
Molecular Weight:
4016.57
CompareProduct No.DescriptionSDSPricing
H9148≥97% (HPLC)
All Photos(1)

Hyperbranched bis-MPA polyester-64-hydroxyl, generation 4

Synonym(s): ALH-64-OH, Hyperbranched Polymer, Hyperpolymer, PFH-64-OH
Empirical Formula (Hill Notation): C315H512O189
CAS No.:
326794-48-3
Molecular Weight:
7323.32
CompareProduct No.DescriptionSDSPricing
686573≥97%
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
Page 1 of 2
Page 1 of 2