Direkt zum Inhalt
Merck

MSQC4

SILuLite SigmaMAb universeller Antikörperstandard human

Synonym(e):

IgG1-Leichtkette, SILuLite SigmaMAb universeller Antikörperstandard, human, SigmaMAb

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Über diesen Artikel

NACRES:
NA.12
UNSPSC Code:
23201100
Clone:
-
Species reactivity:
-
Application:
Citations:
9

Fortfahren mit

Technischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhalten

recombinant

expressed in CHO cells

shipped in

wet ice

storage temp.

−20°C

Quality Level

Verwandte Kategorien

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 4

Dieser Artikel
MSQC3MSQC7MSQC26
shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

Quality Level

200

Quality Level

200

Quality Level

200

Quality Level

200

General description

SILu Lite SigmaMAb ist ein rekombinanter humaner monoklonaler IgG1-Lambda Leichtketten-Antikörper mit einer Molekülmasse von ∼150 kDa, die in CHO-Zellen exprimiert wurden. Er ist für die Optimierung einer akkuraten Analyse der intakten Masse monoklonaler Antikörper, Biosimilars und pharmazeutischer Produkte konzipiert. Eine akkurate Analyse der intakten Masse solcher großen Biomoleküle kann umfassende Informationen über strukturelle und posttranslationale Modifikationen wie die Glycosylierung vermitteln. Andere Informationen, wie Heterogenität, Variation zwischen Chargen, Aminosäurenkürzung und die Verarbeitung, Aggregation sowie der Abbau von N-terminalem Lysin kann bestimmt werden. Die Analyse der intakten Masse mithilfe der Massenspektrometrie ist auch sehr wichtig für Formulierung und Lagerung in der Entwicklung von Arzneistoffen aus therapeutischen monoklonalen Antikörpern.
Es besteht aus zwei identischen schweren Ketten und zwei identischen leichten Ketten. Die schweren Ketten und die leichten Ketten sind durch eine Disulfidbrücke verbunden. Die schweren Ketten sind durch zwei Disulfidbrücke in einer Gelenkdomäne verbunden. Die anderen 12 Cysteinbindungen sind intramolekular auf sechs verschiedene globuläre Domänen beschränkt. Die Antikörpersequenz wurde durch Analyse der intakten Masse und Peptid-Mfapping unter Verwendung vier verschiedener Enzyme bewertet: Chymotrypsin, Endoproteinasen Asp-N und Glu-C sowie Trypsin. Eine Sequenzabdeckung von 100 % wurde erreicht.

Application

SILu Lite SigmaMAb universeller menschlicher Antikörperstandard wurde als Modellsystem verwendet, um die quantitative Beziehung zwischen der Entfaltung monoklonaler Antikörper (Monoclonal Antibody, mAb) in der Gasphase und den einzelnen Stufen der mAb-Glycosylierung zu untersuchen.[1]

Features and Benefits

Die berechneten Molekülmassen der SigmaMAb-Leichtketten und -Schwerketten sowie intakten Proteine mit den am reichlichsten vorhandenen Glycoformen lauten wie folgt:

Beschreibung / Zusammensetzung / Modifikation / Durchschnittliche Masse (Da)

Leichtkette, reduziert / C1006H1555N267O333S7 / Pyroglutaminsäure (Q) / 22942,2

Schwerkette, reduziert / C2181H3393N587O663S16 / (keine Modifikation) / 48957,8
C2237H3485N591O702S16 / G0F / 50403,2
C2243H3495N591O707S16 / G1F / 50565,3
C2249H3505N591O712S16 / G2F / 50727,5

Native intakte Masse, nicht reduziert / C6374H9864N1708O1992S46 / 2 x Pyroglutaminsäure (Q) / 143767,7
C6486H10048N1716O2070S46 / G0F+G0F / 146658,4
C6492H10058N1716O2075S46 / G0F+G1F / 146820,6
C6498H10068N1716O2080S46 / G1F+G1F / 146982,7
C6504H10078N1716O2085S46 / G1F+G2F / 147144,8
C6510H10088N1716O2090S46 / G2F+G2F / 147307,0

Physical form

Erhältlich als lyophilisiertes Pulver mit phosphatgepufferter Kochsalzlösung.

Preparation Note

Die SigmaMAb-Rückgewinnung wird maximiert, wenn Phosphatpuffer mit pH 6–7 zur Rekonstitution des lyophilisierten Produkts verwendet wird.

Analysis Note

SigmaMAb-Schwerkette
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMAb-Leichtkette
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Auch erhältlich als stabiles isotopmarkiertes Produkt SILuMAb (Produktnummer MSQC3)
Packungsgröße basiert auf dem mittels A280 bestimmten Proteingehalt.

Other Notes

PBS ist für die Rekonstitution zu vermeiden.
Röhrcheninhalte durch Hinzufügen von 500 μL Reinstwasser oder Phosphatpuffer und anschließendes energisches Mischen rekonstituieren. Das aufgelöste Produkt kann nach Bedarf weiter verdünnt werden:

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

used together

Ähnliches Produkt

Produkt-Nr.
Beschreibung
Preisangaben

Lagerklasse

11 - Combustible Solids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Jared B Shaw et al.
Analytical chemistry, 90(18), 10819-10827 (2018-08-18)
Compared to traditional collision induced dissociation methods, electron capture dissociation (ECD) provides more comprehensive characterization of large peptides and proteins as well as preserves labile post-translational modifications. However, ECD experiments are generally restricted to the high magnetic fields of FTICR-MS
Daniel A Polasky et al.
Analytical chemistry, 91(4), 3147-3155 (2019-01-23)
Ion mobility-mass spectrometry (IM-MS) has become an important addition to the structural biology toolbox, but separating closely related protein conformations remain challenging. Collision-induced unfolding (CIU) has emerged as a valuable technique for distinguishing iso-cross-sectional protein and protein complex ions through
Yutong Jin et al.
mAbs, 11(1), 106-115 (2018-09-20)
The pharmaceutical industry's interest in monoclonal antibodies (mAbs) and their derivatives has spurred rapid growth in the commercial and clinical pipeline of these effective therapeutics. The complex micro-heterogeneity of mAbs requires in-depth structural characterization for critical quality attribute assessment and
"Collision Induced Unfolding Detects Subtle Differences in Intact Antibody Glycoforms and Associated Fragments.
Tian Y and Brandon T R
International Journal of Mass Spectrometry (2017)
Anna C Robotham et al.
mAbs, 11(4), 757-766 (2019-03-22)
The detection of free sulfhydryls in proteins can reveal incomplete disulfide bond formation, indicate cysteine residues available for conjugation, and offer insights into protein stability and structure. Traditional spectroscopic methods of free sulfhydryl detection, such as Ellman's reagent, generally require

Artikel

Compare columns in resolving medium-sized antibody fragments after digestion with DTT or IdeS using Reversed-Phase Chromatography for analysis.

Intact analysis of Universal Antibody Standard human and Antibody-Drug Conjugate (ADC) Mimic on silica monolithic HPLC columns under various conditions.

A RPLC-MS workflow for mass analysis of non-reduced monoclonal antibody, trastuzumab, including calibration, and system suitability tests.

A RPLC-MS workflow for mass analysis of reduced monoclonal antibody, trastuzumab, including reduction procedures, calibration, and system suitability tests.

Protokolle

A complete workflow for the intact and middle-up mass analysis of reduced and non-reduced monoclonal antibodies based on SEC-MS with sample preparation by protein-A affinity clean-up.

SEC-MS protocol for rapid glycoprofiling of monoclonal antibodies with antibody purification and mass spectrometer calibration.

Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).

SigmaMab Antibody Drug Conjugate Mimic, is a non-toxic drug mimic utilized as a standard for mass spectrometry and high performance liquid chromatography.

Alle anzeigen

Verwandter Inhalt

Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung