Größe auswählen
Über diesen Artikel
Fortfahren mit
Verwandte Kategorien
1 of 4
Dieser Artikel | |||
|---|---|---|---|
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
| Quality Level 200 | Quality Level 200 | Quality Level 200 | Quality Level 200 |
General description
Es besteht aus zwei identischen schweren Ketten und zwei identischen leichten Ketten. Die schweren Ketten und die leichten Ketten sind durch eine Disulfidbrücke verbunden. Die schweren Ketten sind durch zwei Disulfidbrücke in einer Gelenkdomäne verbunden. Die anderen 12 Cysteinbindungen sind intramolekular auf sechs verschiedene globuläre Domänen beschränkt. Die Antikörpersequenz wurde durch Analyse der intakten Masse und Peptid-Mfapping unter Verwendung vier verschiedener Enzyme bewertet: Chymotrypsin, Endoproteinasen Asp-N und Glu-C sowie Trypsin. Eine Sequenzabdeckung von 100 % wurde erreicht.
Application
Features and Benefits
Beschreibung / Zusammensetzung / Modifikation / Durchschnittliche Masse (Da)
Leichtkette, reduziert / C1006H1555N267O333S7 / Pyroglutaminsäure (Q) / 22942,2
Schwerkette, reduziert / C2181H3393N587O663S16 / (keine Modifikation) / 48957,8
C2237H3485N591O702S16 / G0F / 50403,2
C2243H3495N591O707S16 / G1F / 50565,3
C2249H3505N591O712S16 / G2F / 50727,5
Native intakte Masse, nicht reduziert / C6374H9864N1708O1992S46 / 2 x Pyroglutaminsäure (Q) / 143767,7
C6486H10048N1716O2070S46 / G0F+G0F / 146658,4
C6492H10058N1716O2075S46 / G0F+G1F / 146820,6
C6498H10068N1716O2080S46 / G1F+G1F / 146982,7
C6504H10078N1716O2085S46 / G1F+G2F / 147144,8
C6510H10088N1716O2090S46 / G2F+G2F / 147307,0
Physical form
Preparation Note
Analysis Note
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMAb-Leichtkette
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Other Notes
Röhrcheninhalte durch Hinzufügen von 500 μL Reinstwasser oder Phosphatpuffer und anschließendes energisches Mischen rekonstituieren. Das aufgelöste Produkt kann nach Bedarf weiter verdünnt werden:
Legal Information
used together
Ähnliches Produkt
Lagerklasse
11 - Combustible Solids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Artikel
Compare columns in resolving medium-sized antibody fragments after digestion with DTT or IdeS using Reversed-Phase Chromatography for analysis.
Intact analysis of Universal Antibody Standard human and Antibody-Drug Conjugate (ADC) Mimic on silica monolithic HPLC columns under various conditions.
A RPLC-MS workflow for mass analysis of non-reduced monoclonal antibody, trastuzumab, including calibration, and system suitability tests.
A RPLC-MS workflow for mass analysis of reduced monoclonal antibody, trastuzumab, including reduction procedures, calibration, and system suitability tests.
Protokolle
A complete workflow for the intact and middle-up mass analysis of reduced and non-reduced monoclonal antibodies based on SEC-MS with sample preparation by protein-A affinity clean-up.
SEC-MS protocol for rapid glycoprofiling of monoclonal antibodies with antibody purification and mass spectrometer calibration.
Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).
SigmaMab Antibody Drug Conjugate Mimic, is a non-toxic drug mimic utilized as a standard for mass spectrometry and high performance liquid chromatography.
Verwandter Inhalt
Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.
Aktive Filter
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung


