SAB1403094

Sigma-Aldrich

Monoclonal Anti-RAB32, (C-terminal) antibody produced in mouse

clone 1C7, purified immunoglobulin, buffered aqueous solution

NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Biologische Quelle

mouse

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

1C7, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~36.01 kDa

species reactivity

human

Anwendung(en)

capture ELISA: suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... RAB32(10981)

Allgemeine Beschreibung

Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al., 2002 PubMed 11784320).supplied by OMIM

Immunogen

RAB32 (NP_006825, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

Biochem./physiol. Wirkung

RAB32 (Ras-related protein) controls intracellular lipid accumulation in hepatocytes. Absence of it promotes the expression of ATGL (adipose triglyceride lipase) and thereby causes lipolysis. RAB32 is involved in hepatic steatosis. In melanogenesis, it is involved in the transport of important enzymes, such as tyrosinase and Tyrp1 (tyrosinase related protein 1). RAB32 also interacts with and is involved in localization of leucine-rich repeat kinase 2 (LRRK2), a protein associated with Parkinson′s disease. RAB32 is hypermethylated in microsatellite-unstable colon, gastric and endometrial adenocarcinomas.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

BLOC-3 mutated in Hermansky-Pudlak syndrome is a Rab32/38 guanine nucleotide exchange factor.
Gerondopoulos A
Current Biology, 22, 2135-2139 (2012)
Altered gene expression in the superior temporal gyrus in schizophrenia.
Bowden NA
BMC Genomics, 9, 199-199 (2008)
Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
Seto S
Traffic, 12, 407-420 (2011)
RAB32 hypermethylation and microsatellite instability in gastric and endometrial adenocarcinomas.
Shibata D
International Journal of Cancer. Journal International Du Cancer, 119, 801-806 (2006)
LRRK2 transport is regulated by its novel interacting partner Rab32.
Waschbusch D
PLoS ONE, 9, e111632-e111632 (2014)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.