SAB1403144

Sigma-Aldrich

Monoclonal Anti-HEY2, (N-terminal) antibody produced in mouse

clone 2B10, purified immunoglobulin, buffered aqueous solution

Synonym(e):
CHF1, MGC10720, HRT2, HERP1, HESR2, bHLHb32, GRL, GRIDLOCK
NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Biologische Quelle

mouse

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

2B10, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~38.21 kDa

species reactivity

human

Anwendung(en)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... HEY2(23493)

Allgemeine Beschreibung

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. (provided by RefSeq)

Immunogen

HEY2 (NP_036391.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKG

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Kazuya Ono et al.
PLoS genetics, 10(1), e1004118-e1004118 (2014-01-28)
Inner ear mechanosensory hair cells transduce sound and balance information. Auditory hair cells emerge from a Sox2-positive sensory patch in the inner ear epithelium, which is progressively restricted during development. This restriction depends on the action of signaling molecules. Fibroblast...

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.