Merck
All Photos(2)

SAB1403227

Sigma-Aldrich

Monoclonal Anti-CDON, (C-terminal) antibody produced in mouse

clone 2G12, purified immunoglobulin, buffered aqueous solution

Synonym(s):
CDO, MGC111524, ORCAM
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

100

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

2G12, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~38.1 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... CDON(50937)

Allgemeine Beschreibung

CDON and BOC (MIM 608708) are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.[supplied by OMIM

Immunogen

CDON (NP_058648, 1155 a.a. ~ 1263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Lagerklassenschlüssel

13 - Non Combustible Solids

WGK

WGK 1

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service