Merck
All Photos(2)

SAB1403302

Sigma-Aldrich

Monoclonal Anti-METTL2 antibody produced in mouse

clone 2A9, purified immunoglobulin, buffered aqueous solution

Synonym(s):
FLJ11350, FLJ12760, METL, METTL2, METTL2A, PSENIP1
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

100

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

2A9, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~33.59 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... METTL2B(55798)

Allgemeine Beschreibung

This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. (provided by RefSeq)

Immunogen

METTL2 (NP_060866.1, 41 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Lagerklassenschlüssel

13 - Non Combustible Solids

WGK

WGK 1

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service