SAB1403383

Sigma-Aldrich

Monoclonal Anti-COLEC12 antibody produced in mouse

clone 4A7, purified immunoglobulin, buffered aqueous solution

Synonym(e):
SCARA4, SRCL, CLP1, NSR2
NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Qualitätsniveau

100

Biologische Quelle

mouse

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

4A7, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~37.11 kDa

species reactivity

human

Anwendung(en)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... COLEC12(81035)

Allgemeine Beschreibung

This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells. (provided by RefSeq)

Immunogen

COLEC12 (AAH60789, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.