Merck

SAB1403503

Sigma-Aldrich

Monoclonal Anti-RNF148 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

Anmeldento View Organizational & Contract Pricing

Synonym(e):
MGC35222
NACRES:
NA.41

Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

2D3, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2bκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RNF148(378925)

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 4

Dieser Artikel
WH0050862M1WH0009604M1SAB1403483
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

clone

2D3, monoclonal

clone

6D9, monoclonal

clone

4G9, monoclonal

clone

2D8, monoclonal

form

buffered aqueous solution

form

buffered aqueous solution

form

buffered aqueous solution

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

mol wt

-

mol wt

-

mol wt

antigen ~37 kDa

Still not finding the right product?  

Give our Product Selector Tool a try.

Immunogen

RNF148 (NP_932351.1, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Produktnummern werden bei der Anzeige auf der Website mit Packungsgrößen/-menge kombiniert (Beispiel: T1503-25G). Bitte stellen Sie sicher NUR die Produktnummer in das Feld Produktnummer eingeben (Beispiel: T1503).

Beispiel

T1503
Produktnummer
-
25G
Packungsgröße/Menge

Weitere Beispiele:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

eingeben als 1.000309185)

Haben Sie ein Problem? Wenden Sie sich bitte an Technischer Dienst zur Unterstützung

Chargennummern sind auf dem Produktetikett unter „Ch.B.“ (bzw. „Lot“ oder „Batch“ auf englischsprachigen Etiketten) zu finden.

Aldrich-Produkte

  • Wenn Sie eine Lotnummer wie z.B. TO09019TO finden - geben Sie die Lotnummer 09019TO ohne die ersten beiden Buchstaben ein.

  • Wenn Sie eine Lotnummer mit einem Füllcode wie z.B. 05427ES-021 finden, geben Sie die Lotnummer 05427ES ohne den Füllcode -021 ein.

  • Wenn Sie eine Lotnummer mit einem Füllcode wie z.B. STBB0728K9 finden, geben Sie die Lotnummer STBB0728 ohne den Füllcode K9 ein.

Nicht gefunden, was Sie suchen?

In manchen Fällen kann ein COA nicht online verfügbar sein. Wenn Sie ein COA nicht finden können, können Sie es anfragen.

COA anfragen

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.