Merck
All Photos(2)

SAB1403503

Sigma-Aldrich

Monoclonal Anti-RNF148 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

Synonym(s):
MGC35222
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

100

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

2D3, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2bκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... RNF148(378925)

Immunogen

RNF148 (NP_932351.1, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Lagerklassenschlüssel

13 - Non Combustible Solids

WGK

WGK 1

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service