SAB1403512

Sigma-Aldrich

Monoclonal Anti-MUC5B antibody produced in mouse

clone 8C11, ascites fluid

Synonym(e):
MUC5, MG1, MUC9
NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Qualitätsniveau

100

Biologische Quelle

mouse

Antikörperform

ascites fluid

antibody product type

primary antibodies

Klon

8C11, monoclonal

Mol-Gew.

antigen ~38.21 kDa

species reactivity

human

Anwendung(en)

indirect ELISA: suitable
western blot: 1:500-1:1000

Isotyp

IgG2aκ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... MUC5B(727897)

Allgemeine Beschreibung

Mucins are high molecular mass, highly glycosylated macromolecules that are the major components of mucus secretions. MUC5B is a salivary mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva. It is composed of 14.9% protein, 78.1% carbohydrate, and 7% sulfate (Troxler et al., 1995 [PubMed 8554565]).[supplied by OMIM

Immunogen

MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Physikalische Form

Clear solution

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Grant E Duclos et al.
Science advances, 5(12), eaaw3413-eaaw3413 (2019-12-18)
The human bronchial epithelium is composed of multiple distinct cell types that cooperate to defend against environmental insults. While studies have shown that smoking alters bronchial epithelial function and morphology, its precise effects on specific cell types and overall tissue...
Shinji Sumiyoshi et al.
Lung cancer (Amsterdam, Netherlands), 84(3), 281-288 (2014-04-15)
The characteristics of non-terminal respiratory unit (TRU) type lung adenocarcinoma are still unclear. The aim of the present study was to characterize non-TRU type lung adenocarcinoma. We analyzed the expression of mucins MUC5B and MUC5AC, as well as thyroid transcription...
Lina M Salazar-Peláez et al.
PloS one, 10(3), e0119717-e0119717 (2015-03-15)
Vitronectin, a multifunctional glycoprotein, is involved in coagulation, inhibition of the formation of the membrane attack complex (MAC), cell adhesion and migration, wound healing, and tissue remodeling. The primary cellular source of vitronectin is hepatocytes; it is not known whether...

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.