SAB1403563

Sigma-Aldrich

Monoclonal Anti-ABCC6 antibody produced in mouse

clone 5D8, purified immunoglobulin, buffered aqueous solution

Synonym(e):
PXE, EST349056, PXE1, MRP6, ARA, ABC34, MOATE, MLP1
NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Qualitätsniveau

100

Biologische Quelle

mouse

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

5D8, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~37.11 kDa

species reactivity

human

Anwendung(en)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG1κ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... ABCC6(368)

Allgemeine Beschreibung

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. (provided by RefSeq)

Immunogen

ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Alanna Grant et al.
Neuroscience letters, 575, 58-62 (2014-05-28)
A core feature in the pathophysiology of schizophrenia is abnormal development and function of mesocorticolimbic dopamine (DA) circuitry. We have previously shown that variations in the function of the netrin-1 receptor, deleted in colorectal cancer (DCC), result in changes to...
Sarah-Jane Bull et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(29), 9768-9778 (2014-07-18)
Paranodal axoglial junctions are critical for maintaining the segregation of axonal domains along myelinated axons; however, the proteins required to organize and maintain this structure are not fully understood. Netrin-1 and its receptor Deleted in Colorectal Cancer (DCC) are proteins...
Isabelle Brunet et al.
The Journal of clinical investigation, 124(7), 3230-3240 (2014-06-18)
Autonomic sympathetic nerves innervate peripheral resistance arteries, thereby regulating vascular tone and controlling blood supply to organs. Despite the fundamental importance of blood flow control, how sympathetic arterial innervation develops remains largely unknown. Here, we identified the axon guidance cue...

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.