SAB1403816

Sigma-Aldrich

Monoclonal Anti-FGG antibody produced in mouse

clone 1E2, purified immunoglobulin, buffered aqueous solution

NACRES:
NA.41
Preise und Verfügbarkeit sind derzeit nicht verfügbar.

Biologische Quelle

mouse

Antikörperform

purified immunoglobulin

antibody product type

primary antibodies

Klon

1E2, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen ~37 kDa

species reactivity

human

Anwendung(en)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG1κ

Konjugat

unconjugated

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

versandt in

dry ice

Lagertemp.

−20°C

Gene Information

human ... FGG(2266)

Allgemeine Beschreibung

The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Immunogen

FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Deutschland

WGK 3

Flammpunkt F

Not applicable

Flammpunkt C

Not applicable

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.

Soziale Medien

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Forschung. Entwicklung. Produktion.

Wir sind ein führender Anbieter für die globale Life-Science-Industrie mit Lösungen und Dienstleistungen für die Forschung, Entwicklung und Produktion in der Biotechnologie sowie für die Arzneimittelforschung und -produktion in der Pharmaindustrie.

© 2021 Merck KGaA, Darmstadt, Deutschland und/oder Tochterunternehmen. Alle Rechte vorbehalten.

Die Vervielfältigung von Inhalten dieser Internetseite ist ohne Genehmigung strengstens untersagt.