5093

Sigma-Aldrich

CD40 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

NACRES:
NA.75

origen biológico

human

recombinante

expressed in E. coli

descripción

0.1 mg of recombinant human CD40 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.

esterilidad

Filtered sterilized solution

ensayo

≥90% (SDS-PAGE)

formulario

liquid

envase

pkg of 100 μg

concentración

0.5 mg protein/mL

aplicaciones

cell culture | mammalian: suitable

nº de acceso

NP_690593

enviado en

dry ice

temp. de almacenamiento

−20°C

Gene Information

human ... CD40LG(959)

Categorías relacionadas

Aplicación

Coating a plate well (6 well plate) with this recombinant CD40 protein in neuronal cell specific medium at 1-10 μg/well (6 well plate) allows for 1) human neuronal cell / receptor interaction studies or 2) use as a culture matrix protein for human neuronal axon connection studies in vitro.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.

Secuencia

MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL

Nota de preparación

The full-length extracellular domain of the human CD40 gene (54-608 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 2

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Joel N Glasgow et al.
PloS one, 4(12), e8355-e8355 (2009-12-23)
Successful gene therapy will require targeted delivery vectors capable of self-directed localization. In this regard, the use of antibodies or single chain antibody fragments (scFv) in conjunction with adenovirus (Ad) vectors remains an attractive means to achieve cell-specific targeting. However...
Mohsen Arabpour et al.
Molecular immunology, 114, 172-178 (2019-07-30)
B lymphocytes with regulatory or effector functions synthesize granzyme B (GZMB). We investigated the frequency and phenotype of GZMB-producing B cells in breast tumor-draining lymph nodes (TDLNs). Mononuclear cells were isolated from 48 axillary lymph nodes and were stimulated with...
E A Clark et al.
Proceedings of the National Academy of Sciences of the United States of America, 83(12), 4494-4498 (1986-06-01)
Two human B-cell differentiation antigens, Bp35 and Bp50, apparently play distinct roles as signal receptors in B-cell activation. Monoclonal antibodies (mAbs) to either Bp35 or Bp50 deliver positive signals to B cells that stimulate their transition through the cell cycle....
Priyadharshini Narayanan et al.
The Journal of clinical investigation, 121(4), 1524-1534 (2011-03-09)
The in vivo therapeutic efficacy of DC-based cancer vaccines is limited by suboptimal DC maturation protocols. Although delivery of TLR adjuvants systemically boosts DC-based cancer vaccine efficacy, it could also increase toxicity. Here, we have engineered a drug-inducible, composite activation...
Mark Melchers et al.
Retrovirology, 8, 48-48 (2011-06-22)
One reason why subunit protein and DNA vaccines are often less immunogenic than live-attenuated and whole-inactivated virus vaccines is that they lack the co-stimulatory signals provided by various components of the more complex vaccines. The HIV-1 envelope glycoprotein complex (Env)...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.