APREST79702

PrEST Antigen ESR1

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonym(s): ESR, Era, NR3A1

Properties

• recombinante: expressed in E. coli
• Nivel de calidad: 100
• ensayo: >80% (SDS-PAGE)
• formulario: buffered aqueous solution
• mol peso: predicted mol wt 33 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentración: ≥0.5 mg/mL
• secuencia del inmunógeno: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
• Ensembl | nº de acceso humano: ENSG00000091831
• Nº de acceso UniProt: P03372
• enviado en: wet ice
• temp. de almacenamiento: −20°C
• Gene Information: human ... ESR1(2099)

Description

Descripción general

Recombinant protein fragment of Human ESR1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicación

Suitable as a blocking agent using corresponding antibodies.

Ligadura / enlace

Corresponding Antibodies AMAB90867 , HPA000449.

Forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparación

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• WGK: WGK 2
• Punto de inflamabilidad F: Not applicable
• Punto de inflamabilidad C: Not applicable