AV00001

Sigma-Aldrich

Anti-CDK4 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:
Anti-Cyclin-dependent kinase 4
Número MDL:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

IgG fraction of antiserum

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

34 kDa

species reactivity

human

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... CDK4(1019)

Descripción general

CDK4 is a Ser/Thr kinase that regulates G1 phase progression in cells. Alterations in CDK4 have been linked to several cancers. Rabbit Anti-CDK4 (AB1) antibody binds to dog, bovine, pig, rat, and human CDK4.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CDK4

Aplicación

Rabbit Anti-CDK4 (AB1) antibody can be used for western blot assays at 1μg/ml.

Secuencia

Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis

Certificado de origen

Shang-Hsun Yang et al.
Molecular neurobiology, 57(10), 4090-4105 (2020-07-16)
Mild hypothermia has promising effects in the treatment of acute brain insults and also affects cell cycle progression. Mitochondrial dynamics, fusion and fission, are changed along with the cell cycle and disrupted in neurodegenerative diseases, including Parkinson's disease (PD). However...
Chaitali Misra et al.
Human molecular genetics, 23(19), 5025-5035 (2014-05-27)
Mutations in GATA4 and TBX5 are associated with congenital heart defects in humans. Interaction between GATA4 and TBX5 is important for normal cardiac septation, but the underlying molecular mechanisms are not well understood. Here, we show that Gata4 and Tbx5...
Guoyan Liu et al.
The Journal of pathology, 233(3), 308-318 (2014-03-08)
Ovarian carcinoma is the most lethal gynaecological malignancy. Better understanding of the molecular pathogenesis of this disease and effective targeted therapies are needed to improve patient outcomes. MicroRNAs play important roles in cancer progression and have the potential for use...
Wen Pan et al.
Scientific reports, 4, 6812-6812 (2014-10-30)
Cytokines are soluble proteins that exert their functions by binding specific receptors. Many cytokines play essential roles in carcinogenesis and have been developed for the treatment of cancer. In this study, we identified a novel potential cytokine using immunogenomics designated...
Jinhee Kim et al.
Biochimie, 105, 36-44 (2014-06-15)
Overexpression of the aromatase enzyme CYP19 has been implicated in the onset of estrogen-dependent breast carcinogenesis. Obacunone, a natural compound present in citrus fruits, has been demonstrated for various biological activities including anti-cancer and anti-inflammatory properties. In the present study...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico