AV03017

Sigma-Aldrich

Anti-CDK4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:
Anti-Cyclin-dependent kinase 4
Número MDL:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

IgG fraction of antiserum

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

34 kDa

species reactivity

rabbit, canine, rat, human, pig

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... CDK4(1019)

Inmunógeno

The immunogen for anti-CDK4 antibody: synthetic peptide derected towards the C terminal of human CDK4

Aplicación

Anti-CDK4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

CDK4 forms a complex with cyclin D1 and regulates cell proliferation during the G1 phase. It also binds with human p16 and inhibits the activity of the CDK4/cyclin D complex in cells that lack retinoblastoma protein. CDK4 forms a complex with pRB and E2F1 proteins that modulate the secretion of insulin by pancreatic β-cells.

Secuencia

Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Lluis Fajas et al.
Islets, 2(1), 51-53 (2010-11-26)
Pancreatic β-cells are sensors of circulating glucose levels that control insulin secretion through a finely-tuned process. Under hyperglycemic conditions, glucose enters the cell, generates ATP, leading to a subsequent closure of voltage-dependent ATP channels, membrane depolarization, Ca²(+) entry and exocytosis...
M Serrano et al.
Nature, 366(6456), 704-707 (1993-12-16)
The division cycle of eukaryotic cells is regulated by a family of protein kinases known as the cyclin-dependent kinases (CDKs). The sequential activation of individual members of this family and their consequent phosphorylation of critical substrates promotes orderly progression through...
Chenguang Wang et al.
Cell cycle (Georgetown, Tex.), 10(1), 57-67 (2011-01-05)
The c-myc is a proto-oncogene that manifests aberrant expression at high frequencies in most types of human cancer. C-myc gene amplifications are often observed in various cancers as well. Ample studies have also proved that c-myc has a potent oncogenicity...
Chaitali Misra et al.
Human molecular genetics, 23(19), 5025-5035 (2014-05-27)
Mutations in GATA4 and TBX5 are associated with congenital heart defects in humans. Interaction between GATA4 and TBX5 is important for normal cardiac septation, but the underlying molecular mechanisms are not well understood. Here, we show that Gata4 and Tbx5...
Guoyan Liu et al.
The Journal of pathology, 233(3), 308-318 (2014-03-08)
Ovarian carcinoma is the most lethal gynaecological malignancy. Better understanding of the molecular pathogenesis of this disease and effective targeted therapies are needed to improve patient outcomes. MicroRNAs play important roles in cancer progression and have the potential for use...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.